CJC/Ipamorelin is a two-peptide research blend of CJC-1295 No DAC and Ipamorelin, 5 mg of each. CJC-1295 No DAC, also called Mod GRF 1-29, is a 29-residue growth hormone-releasing hormone analog, YADAIFTQSYRKVLAQLSARKLLQDILSR-NH2 with D-alanine at position 2 (C152H252N44O42, average mass about 3367.9 g/mol, CAS 863288-34-0 and 446036-97-1). Ipamorelin is the pentapeptide Aib-His-D-2-Nal-D-Phe-Lys-NH2 (C38H49N9O5, about 711.85 g/mol, CAS 170851-70-4), studied at the ghrelin receptor rather than the GHRH receptor. The vial is labeled 5/5 mg and is supplied strictly for laboratory research use only.
Ask for the analytical documentation of any lot.
HPLC is the method used to measure purity
Ask for the report for a specific lot through the contact page
Supplied for laboratory research use only
Mass spectrometry is the method used to confirm identity
CJC/Ipamorelin is the label for one vial that holds two separate peptides, CJC-1295 No DAC and Ipamorelin, rather than a single molecule. They share no sequence and no receptor, which is why every identifier below is listed per component. The label carries the name followed by two numbers, and 5/5 mg means 5 mg of each peptide.
The CJC half is the 29-residue form with no DAC group. DAC stands for Drug Affinity Complex, a lysine-linked maleimidopropionyl group that belongs to a different compound, and this molecule ends at residue 29 without it. Chemists also write this half as Mod GRF 1-29, modified GRF(1-29) or tetrasubstituted GRF(1-29), and sellers use CJC-1295 without DAC or W/O DAC. The other half, Ipamorelin, is a short synthetic chain built partly from non-standard residues. Veracue supplies the vial for research use only.
| Product name | CJC/Ipamorelin (CJC-1295 No DAC plus Ipamorelin; also written CJC Ipamorelin blend) |
| Components | Two separate peptides in one vial |
| Label strength | 5/5 mg (5 mg of each peptide) |
| CJC-1295 No DAC | 29 residues, C-terminal amide, C152H252N44O42, average mass about 3367.9 g/mol, CAS 863288-34-0 (446036-97-1 is also listed for this peptide) |
| CJC-1295 No DAC changes from native GHRH(1-29) | D-Ala2, Gln8, Ala15, Leu27 |
| Ipamorelin | 5 residues, C38H49N9O5, average mass about 711.85 g/mol, CAS 170851-70-4 |
| Size offered | One size, the 5/5 mg vial |
| Research designation | Research Use Only |
Formula, mass and registry numbers are reference values for the free peptides and are not lot results. Chemical form, physical form, purity and storage questions for a particular vial belong in a documentation request, and documentation can be requested through the contact page.
Residues read Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2, or YADAIFTQSYRKVLAQLSARKLLQDILSR-NH2 in one-letter code. Set beside native GHRH(1-29), four positions differ: D-alanine replaces L-alanine at 2, glutamine replaces asparagine at 8, alanine replaces glycine at 15 and leucine replaces methionine at 27. Together they add three CH2 groups and remove the only sulfur atom, which is how the formula ends up at C152H252N44O42.
Ipamorelin is the five-residue chain Aib-His-D-2-Nal-D-Phe-Lys-NH2 with a C-terminal amide. Three of its five residues are non-standard or D-configured: aminoisobutyric acid (Aib), D-2-naphthylalanine and D-phenylalanine. Together with its short length, that makes it structurally unrelated to anything in the GHRH family.
| Feature | CJC-1295 No DAC | Ipamorelin |
|---|---|---|
| Length | 29 residues | 5 residues |
| Molecular formula | C152H252N44O42 | C38H49N9O5 |
| Average mass | About 3367.9 g/mol | About 711.85 g/mol |
| CAS Registry Number | 863288-34-0 (446036-97-1 also listed) | 170851-70-4 |
| Notable chemistry | D-Ala2 plus Gln8, Ala15 and Leu27 changes to the native GHRH(1-29) chain | Aib, D-2-Nal and D-Phe residues |
| Receptor studied | GHRH receptor | Ghrelin receptor (GHS-R1a) |
| Signaling context | Adenylyl cyclase and cAMP | Phospholipase C and calcium |
The masses sit about 2656 Da apart, 3367.9 against 711.85, so the two components cannot be mistaken for each other in a mass reading.
CJC-1295 No DAC is studied at the GHRH receptor, a G protein-coupled receptor on pituitary somatotroph cells that signals mainly through adenylyl cyclase and cyclic AMP. Ipamorelin is studied as an agonist at GHS-R1a, the ghrelin receptor, whose signaling runs mainly through phospholipase C and calcium. Different receptors and different second-messenger routes mean that a finding about one peptide says nothing on its own about the other, or about the pair.
A result obtained with one component alone does not describe the mixture, and this listing describes no combined effect. Everything here is molecular reference material, with no dosing, administration or usage guidance of any kind attached to it.
The bare name CJC-1295 was first attached to the albumin-binding compound, and the No DAC and without DAC tags came later for the 29-residue chain. When a paper or supplier sheet says only CJC-1295, check the methods for the structure or the CAS number. The 29-residue peptide in this vial is 863288-34-0, with 446036-97-1 also listed, while the DAC-bearing compound is 446262-90-4, and findings reported for one should not be carried over to the other.
Peptides rarely appear at their neutral mass in electrospray spectra. They show as multiply charged ions, and the table gives calculated m/z values on an average-mass basis, taken as the reference mass plus one proton per charge.
| Component | Average mass (g/mol) | Ions to look for (m/z) |
|---|---|---|
| CJC-1295 No DAC | About 3367.9 | 3+ near 1123.6, 4+ near 843.0, 5+ near 674.6 |
| Ipamorelin | About 711.85 | 1+ near 712.9, 2+ near 356.9 |
A sample of the mixture should show both sets of peaks, and a spectrum with only one of them would suggest a component is missing. Sodium or potassium adducts push peaks to higher m/z, so work back from an observed ion to a neutral mass before checking it against the numbers above.
| Compound | Average mass (g/mol) | Gap to CJC-1295 No DAC | 4+ ion (m/z) |
|---|---|---|---|
| CJC-1295 No DAC | About 3367.9 | None | 843.0 |
| CJC-1295 with DAC | About 3647.2 | About 279 Da heavier | 912.8 |
| Sermorelin | About 3357.9 | About 10 Da lighter | 840.5 |
A CJC signal near 3647 would point to the DAC-bearing compound, which is far enough away to be obvious. Sermorelin is the harder one, only 10 Da lower and about 2.5 units of m/z at 4+, so telling it from the No DAC peptide needs a calibrated instrument with adequate resolution.
Lot documentation describes one lot, so match its lot number to the vial before reading anything else. For a blend, a single purity figure or a single mass is not enough. Useful items to look for are an identity result for each peptide, a stated amount of each, the chemical form, the test date and the laboratory behind it. A combined purity figure can hide a shortfall in one component while the other looks clean.
Anyone who wants that paperwork for a particular vial can ask through the contact page.
No. A blend should give a separate peak for each peptide, and even then the retention time does not say which molecule each peak is. Identity comes from a mass result for each component.
D and L forms of an amino acid have identical mass, so a spectrum cannot separate them. D-alanine at position 2 of the CJC peptide adds no atoms, and the D-2-Nal and D-Phe residues of Ipamorelin behave the same way, so confirming them takes chiral amino acid analysis or comparison with a reference standard.
Save the listing text as it read on the day of purchase, the label strength, any documentation received and the date the vial arrived, along with the experiments that used it. That makes an unexpected result easy to trace.
CJC/Ipamorelin vials hold research material, sold for laboratory work and analytical characterization. The contents are not for human or veterinary use, are not a drug, dietary supplement, cosmetic or food, and must not be ingested, injected or otherwise administered. The listing contains no dosing, administration or usage guidance of any kind. Purchasers are expected to be qualified researchers or institutions, and lawful handling is their responsibility. Policies that apply across the whole site are in the Medical Disclaimer and the Terms and Conditions.
RESEARCH PEPTIDE
Check the mass: CJC-1295 W/DAC is C165H269N47O46, about 3647.2 g/mol (CAS 446262-90-4), not 3367.9 like its unmodified core. Research use only.
RESEARCH PEPTIDE
Which CJC-1295 is it? This is the 29-residue peptide with no DAC group (C152H252N44O42, about 3367.9 g/mol). Sold in 10 mg, for research use only.
RESEARCH PEPTIDE
IGF-LR3 is an 83-residue analog, longer than native IGF-1 (CAS 143045-27-6). Read the identity and COA notes. 1 mg vial, research use only.
RESEARCH PEPTIDE
Tesa/IPA is two peptides in one vial, tesamorelin and ipamorelin, so a COA should confirm both. 6/3 and 13/3 mg vials, research use only.
