Tesamorelin Spray supplies Tesamorelin, also written GRF 1-44, a 44-residue growth hormone-releasing factor analog carrying a trans-3-hexenoyl group on its N-terminal tyrosine and an amidated C-terminus, sequence YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2. Its free-base reference values are C221H366N72O67S, about 5135.9 g/mol, CAS 218949-48-5, with CAS 901758-09-6 listed for a commonly supplied acetate salt. The N-terminal modification is what distinguishes it from the plain 29-residue GHRH fragment used elsewhere in this catalog. Offered in 10 mg and 20 mg spray-dispensed sizes for laboratory research use only.
Ask for the analytical documentation of any lot.
HPLC is the method used to measure purity
Ask for the report for a specific lot through the contact page
Supplied for laboratory research use only
Mass spectrometry is the method used to confirm identity
Tesamorelin Spray is Veracue’s spray-dispensed packaging of Tesamorelin, a synthetic peptide that keeps the complete native 44-residue GRF chain and adds a trans-3-hexenoyl group to the N-terminal tyrosine, with an amidated C-terminus. The underlying molecule is identical to the one documented on Veracue’s Tesamorelin vial listing; only the packaging and dispensing format differ between the two listings.
"Spray" is a packaging and dispensing descriptor, nothing more. It does not establish a route, a concentration, or a formulation, and none of those specifics should be inferred from the product name. Chemical form, concentration, fill volume and storage conditions are reported on each lot’s own documentation and can be requested through the contact page.
| Product name | Tesamorelin Spray (molecule also written GRF 1-44) |
| Packaging format | Spray-dispensed, Research Use Only |
| Compound class | Growth hormone-releasing factor (GRF) analog |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 |
| Length | 44 amino acids, linear, C-terminal amide |
| N-terminal modification | trans-3-hexenoyl group on the N-terminal tyrosine |
| Molecular formula (free-base reference value) | C221H366N72O67S |
| Molecular weight (free-base reference value) | About 5135.9 g/mol (average) |
| CAS Registry Number (free base) | 218949-48-5 |
| CAS Registry Number (acetate salt) | 901758-09-6 |
| PubChem CID | 16137828 |
| Receptor context | GHRH receptor (GHRHR) |
| Sizes offered | 10 mg and 20 mg |
| Research designation | Research Use Only |
Veracue lists Tesamorelin in more than one packaging format because research groups source and track material differently depending on how it is packaged. Keeping the formats as separate listings keeps lot records, images and documentation specific to the packaging a researcher actually ordered, rather than mixing records across formats.
Tesamorelin Spray and Veracue’s Tesamorelin vial listing describe one molecule: the complete native GRF(1-44) chain with L-alanine at position 2 and a trans-3-hexenoyl group added to the N-terminal tyrosine. Packaging format has no bearing on sequence, formula or mass, so these values are identical across both listings.
No. The compound reported under this listing is the same GRF(1-44) analog reported under the vial listing. What differs between the two listings is how the material is packaged and dispensed, not its chemical identity.
In Veracue’s catalog, "Spray" is a packaging and dispensing term, comparable to "vial" or "powder" on other listings. It tells a researcher how the product is dispensed from its container. It does not specify a concentration, a carrier, a route, or a formulation, and it is not shorthand for any particular method of use. Those details, where applicable, live in lot-specific documentation rather than in the catalog name.
Treating a packaging word as a technical specification is a common source of error when comparing listings across suppliers. A researcher documenting materials in a methods section should cite the lot’s own documentation for format-specific details rather than inferring them from the word "Spray" alone.
| Feature | Tesamorelin | Sermorelin | Ipamorelin | CJC-1295 |
|---|---|---|---|---|
| Structure | GRF(1-44) with N-terminal trans-3-hexenoyl group | Unmodified GRF(1-29) amide | Synthetic pentapeptide (Aib-His-D-2-Nal-D-Phe-Lys-NH2) | GRF(1-29) with four substitutions plus a modified lysine |
| Peptide length | 44 residues | 29 residues | 5 residues | 29 residues plus modified lysine |
| Position 2 | L-alanine | L-alanine | Not applicable | D-alanine |
| Receptor | GHRH receptor | GHRH receptor | Ghrelin (GHS) receptor | GHRH receptor |
| Signaling context | Adenylyl cyclase / cAMP | Adenylyl cyclase / cAMP | Phospholipase C / calcium | Adenylyl cyclase / cAMP |
| Catalog formats Veracue offers | Vial and spray | Vial and spray | Vial and spray | Vial and spray |
This table compares molecular structure and receptor context only. Catalog format is listed separately because it is a packaging detail, not a property of the molecule itself, and it does not change which receptor a given peptide engages.
The free peptide carries CAS 218949-48-5, and a commonly supplied acetate salt carries its own number, CAS 901758-09-6. Both describe the identical 44-residue sequence; the counterion sitting alongside the chain is what differs, not the sequence itself. A vial or spray-top unit filled by total mass holds peptide plus counterion plus residual water, so net peptide content runs lower than the fill weight, and that figure is lot-specific rather than something the catalog listing can state.
Confirming which form a given lot carries, free base or acetate, matters before any mass-based calculation is attempted, since using the wrong reference weight can carry a silent error through the rest of the math. The form actually supplied is reported on the lot’s own certificate, regardless of packaging format.
The GHRH receptor is a class B G protein-coupled receptor expressed on pituitary somatotroph cells and signals mainly through adenylyl cyclase and cyclic AMP. Tesamorelin, in either packaging format Veracue offers, is studied as a reference ligand on the GHRH side of this receptor family, separate from ghrelin-receptor agonists such as Ipamorelin that reach the same downstream cell type through a different receptor.
Because "Spray" and "vial" describe packaging rather than chemistry, a methods section should still name the molecule precisely by sequence or CAS number, and separately note the catalog format and lot number actually used. This page provides molecular reference information and general research context only, and Veracue provides no dosing, administration or usage guidance of any kind.
Identity and purity for Tesamorelin Spray are established the same way as for any Tesamorelin lot: reverse-phase HPLC for chromatographic purity, and mass spectrometry (typically ESI-MS or MALDI-TOF) to confirm that the observed mass matches the molecule’s theoretical value. HPLC alone shows that most detected material elutes together; it does not by itself confirm identity, since a closely related peptide can produce an equally clean trace.
Packaging format has no bearing on which analytical methods apply. A spray-dispensed lot and a vial lot of the same molecule are verified against the same sequence, formula and mass references, listed on the Tesamorelin at a Glance table above.
| Method | Tells a researcher | Does not prove by itself |
|---|---|---|
| RP-HPLC | Chromatographic purity (area %) | Identity |
| ESI-MS / MALDI-TOF | Mass consistent with Tesamorelin | Sequence order; purity |
| Tandem MS | Sequence evidence | Quantity or purity |
| Ion chromatography | Which counterion (free base vs. acetate) is present | Peptide purity or identity |
A certificate of analysis describes one lot, never a packaging format or a compound in general. Before relying on any figure, confirm that the lot number on the certificate matches the container and the order record for the spray-format unit received.
A complete certificate separates product identity, lot number, chemical form (free base or acetate), HPLC result with chromatogram, mass spectrometry result with observed and theoretical mass, test date and testing laboratory. Where concentration or fill-volume figures are relevant to a spray-format unit, they are reported on that lot’s own documentation rather than inferred from the catalog listing. The certificate page explains how to request lot documentation for either format.
No. The verification question is the same: does this lot match the stated molecule, and is the purity figure paired with a mass result from the same lot. Packaging format does not change what counts as adequate documentation.
Tesamorelin free base and Tesamorelin acetate share one sequence but carry two different CAS numbers and reference masses. If a lot’s documentation leaves the form unstated, any mass-based calculation can carry a silent error. Confirm the form on the lot’s certificate and use the matching reference weight, regardless of packaging format.
For each lot, keep the catalog listing snapshot, the lot-specific certificate, the stated chemical form, the receipt date, labeled storage conditions, and the packaging format actually received. Recording format alongside the usual identity fields keeps multi-format catalogs like this one traceable lot to lot.
Tesamorelin Spray is supplied for laboratory research and analytical characterization only. It is not intended for human or veterinary use, or for ingestion, injection or any form of administration. This page contains no dosing, administration or usage guidance of any kind, and the word "Spray" in the product name describes Veracue’s packaging and dispensing format only. See the Medical Disclaimer and the Terms and Conditions for sitewide policies.
RESEARCH PEPTIDE
Spray bottle pairing a 29-residue GHRH analog with the pentapeptide Ipamorelin, 5 mg of each and 45 sprays per bottle. Laboratory research use only.
RESEARCH PEPTIDE
GLP-T Spray pairs a 39-residue peptide, LY3298176 (CAS 2023788-19-2), with a C20 diacid on lysine 20. 10 to 60 mg, research use only, 45 sprays a bottle.
RESEARCH PEPTIDE
A 28-residue, N-acetylated peptide at 3108.3 g/mol, spray-dispensed in a 10 mg bottle with 45 sprays. Supplied for research use only.
RESEARCH PEPTIDE
Seven residues, a lactam ring and an amide terminus: Melanotan II, CAS 121062-08-6, in a 10 mg bottle of 45 sprays. Laboratory research only.
