GLP-S Spray is the spray-dispensed form of GLP-S, a lipidated analog of GLP-1(7-37). Its 31-residue chain, HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG, carries aminoisobutyric acid at position 8 and an acylated lysine at position 26. Reference values are formula C187H291N45O59, average mass about 4113.58 g/mol and CAS 910463-68-2, with the C18 diacid side chain accounting for the mass above the bare backbone. Each bottle holds 45 sprays and comes in 5, 10, 20 or 30 mg strengths, supplied strictly for laboratory research use only.
Ask for the analytical documentation of any lot.
HPLC is the method used to measure purity
Ask for the report for a specific lot through the contact page
Supplied for laboratory research use only
Mass spectrometry is the method used to confirm identity
| Product name | GLP-S Spray |
| Format | Spray-dispensed bottle, 45 sprays per bottle |
| Sizes offered | 5 mg, 10 mg, 20 mg and 30 mg |
| Peptide | GLP-S, a lipidated 31-residue analog of GLP-1(7-37) |
| Chain | HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG, numbered 7 to 37, with Aib at position 8 (written as A) and arginine at position 34 |
| Acyl group on lysine 26 | C18 diacid joined through a gamma-glutamic acid and two-unit OEG spacer |
| Molecular formula | C187H291N45O59 |
| Average mass | About 4113.58 g/mol |
| Monoisotopic mass | 4111.1154 Da |
| CAS Registry Number | 910463-68-2 |
| PubChem CID | 56843331 |
| Receptor target | GLP-1 receptor, agonist in receptor assays |
| Research designation | Research Use Only |
Formula and masses are calculated reference figures for the acylated peptide, not Veracue lot results.
The active material is GLP-S, a 31-residue peptide that tracks the human GLP-1(7-37) sequence except at two positions and bears an acyl chain on its one lysine. Veracue offers it in a spray-dispensed bottle with 45 sprays, at four strengths, for laboratory research use only.
For salt form, purity and lot-level results, use the contact page to request the documentation for your lot.
| Part | Where | What it is |
|---|---|---|
| Peptide chain | Positions 7 to 37 of GLP-1 numbering | 31 residues, 29 of them identical to native GLP-1(7-37) |
| Aib | Position 8 | Aminoisobutyric acid in place of alanine, which blocks DPP-4 cleavage |
| Arginine | Position 34 | Replaces the native lysine, leaving lysine 26 as the only lysine |
| Acylated lysine | Position 26 | Carries the side chain on its amine |
| Spacer | Between lysine and diacid | Gamma-glutamic acid plus two OEG units (8-amino-3,6-dioxaoctanoic acid, also written AEEA) |
| Fatty diacid | End of the side chain | Octadecanedioic acid, a C18 diacid that binds albumin reversibly |
| C-terminus | Position 37 | Free acid |
Counting the residues gives one histidine, one tryptophan and two arginines, and no cysteine or methionine. There are therefore no disulfide bridges and no methionine oxidation to track, which leaves the side chain as the main structural feature to verify.
GLP1R is the receptor GLP-S is built to engage, a class B (secretin-like) G protein-coupled receptor that also binds native GLP-1. Binding and signaling studies in receptor assays are the usual setting, and the engineered changes bear on stability and albumin association, not on which receptor is engaged.
Because the diacid binds albumin reversibly, whether albumin is present in an assay system is worth recording next to the lot number. This is a note on interpreting results, not a handling or preparation instruction.
Twenty-nine of 31 residues, about 94 percent. The differences sit at positions 8 and 34 and in the acyl group, and together they change the formula, mass and CAS number.
It adds a spacer and a C18 diacid to lysine 26, so a correct lot reads near 4.1 kDa. A result near the mass of the bare backbone points to a lost side chain and should not be read as a match.
A peptide of 4113.58 g/mol seldom appears at its neutral mass in electrospray MS. It carries several charges at once, and the table gives the calculated m/z for the first four, derived from the monoisotopic mass of 4111.1154 Da with one proton mass added per charge.
| Charge state | Calculated m/z |
|---|---|
| [M+2H]2+ | 2056.56 |
| [M+3H]3+ | 1371.38 |
| [M+4H]4+ | 1028.79 |
| [M+5H]5+ | 823.23 |
These are formula-derived reference values, not Veracue lot results. An average-mass reading sits a little higher than a monoisotopic one, which is why any report has to say which convention it follows.
A record covers one lot. Confirm that its lot number matches the bottle label, that the expected mass is stated with its convention, and that the identity result speaks to the side chain and not only the backbone. A purity percentage should name its method.
Lot documentation can be requested as described on the certificate page.
Contact the Veracue team about a specific lot, or look through the certificate library.
GLP-S Spray is offered for laboratory research only. It is not meant for human or veterinary use, and it is not a drug, supplement, food or cosmetic. The FDA has not evaluated it. Veracue gives no dosing, administration or usage guidance of any kind, and the science described here is laboratory-level information, not medical advice. Sitewide policies are in the Medical Disclaimer and the Terms and Conditions.
Buyers are expected to be qualified researchers or institutions, and to work with the material in line with all applicable laws.
Analytical results describe the lot that was tested and nothing else. Note the lot number from the bottle label alongside every experiment that uses the material.
RESEARCH PEPTIDE
Spray bottle pairing a 29-residue GHRH analog with the pentapeptide Ipamorelin, 5 mg of each and 45 sprays per bottle. Laboratory research use only.
RESEARCH PEPTIDE
GLP-T Spray pairs a 39-residue peptide, LY3298176 (CAS 2023788-19-2), with a C20 diacid on lysine 20. 10 to 60 mg, research use only, 45 sprays a bottle.
RESEARCH PEPTIDE
A 28-residue, N-acetylated peptide at 3108.3 g/mol, spray-dispensed in a 10 mg bottle with 45 sprays. Supplied for research use only.
RESEARCH PEPTIDE
Seven residues, a lactam ring and an amide terminus: Melanotan II, CAS 121062-08-6, in a 10 mg bottle of 45 sprays. Laboratory research only.
