Cagrilintide Spray delivers Cagrilintide, development code AM833, a 37-residue amylin analogue carrying a C20 fatty diacid attached at the lysine in position 1 through a hydrophilic linker. The sequence is KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP, folded by an intramolecular disulfide bridge, with free-acid formula C194H312N54O59S2, about 4,409 g/mol, CAS 1415456-99-3. The lipid attachment is what separates it from unmodified amylin fragments and should be confirmed on any lot’s documentation. Offered as a 10 mg spray-dispensed size for laboratory research use only.
Ask for the analytical documentation of any lot.
HPLC is the method used to measure purity
Ask for the report for a specific lot through the contact page
Supplied for laboratory research use only
Mass spectrometry is the method used to confirm identity
Cagrilintide Spray is Veracue’s spray-dispensed packaging of Cagrilintide, a synthetic, lipidated analogue of amylin coded AM833. The underlying molecule is identical to the one documented on Veracue’s Cagrilintide vial listing; only the packaging and dispensing format differ between the two listings.
"Spray" is a packaging and dispensing descriptor, nothing more. It does not establish a route, a concentration, or a formulation, and none of those specifics should be inferred from the product name. Chemical form, concentration, fill volume and storage conditions are reported on each lot’s own documentation and can be requested through the contact page.
| Product name | Cagrilintide Spray |
| Development code | AM833 |
| Packaging format | Spray-dispensed, Research Use Only |
| Molecular class | Acylated (lipidated) amylin analogue |
| Backbone | 37-amino-acid linear peptide with an intramolecular disulfide bridge |
| Lipid attachment | C20 fatty diacid on the lysine at position 1, through a hydrophilic linker |
| Sequence | KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP |
| Molecular formula (free acid) | C194H312N54O59S2 |
| Molecular weight (free acid) | About 4,409 g/mol |
| CAS Registry Number | 1415456-99-3 |
| Size offered | 10 mg |
| Research designation | Research Use Only |
Veracue lists Cagrilintide in more than one packaging format because research groups source and track material differently depending on how it is packaged. Keeping the formats as separate listings keeps lot records, images and documentation specific to the packaging a researcher actually ordered, rather than mixing records across formats.
Cagrilintide Spray and Veracue’s Cagrilintide vial listing describe one molecule: a 37-amino-acid linear peptide with an intramolecular disulfide bridge and a C20 fatty diacid conjugated at the lysine in position 1. Packaging format has no bearing on sequence, formula or mass, so these values are identical across both listings.
No. The compound reported under this listing is the same AM833 lipidated amylin analogue reported under the vial listing. What differs between the two listings is how the material is packaged and dispensed, not its chemical identity.
In Veracue’s catalog, "Spray" is a packaging and dispensing term, comparable to "vial" on other listings. It tells a researcher how the product is dispensed from its container. It does not specify a concentration, a carrier, a route, or a formulation, and it is not shorthand for any particular method of use. Those details, where applicable, live in lot-specific documentation rather than in the catalog name.
Treating a packaging word as a technical specification is a common source of error when comparing listings across suppliers. A researcher documenting materials in a methods section should cite the lot’s own documentation for format-specific details rather than inferring them from the word "Spray" alone.
Receptor pharmacology work characterizes Cagrilintide as a nonselective agonist across calcitonin-family G protein-coupled receptors, with reported binding at amylin receptors and the calcitonin receptor. It is commonly described in the literature as a dual amylin and calcitonin receptor agonist, a classification that holds for Cagrilintide regardless of which packaging format a lot is supplied in.
| Item | Detail |
|---|---|
| Receptor systems | Amylin receptors (AMY1 to AMY3) and the calcitonin receptor (CTR) |
| Activity type | Nonselective agonist in receptor assays |
| Receptor family | Calcitonin-family G protein-coupled receptors |
| Catalog formats Veracue offers | Vial and spray |
This table reports receptor-binding classification only. Catalog format is listed separately because it is a packaging detail, not a property of the molecule itself, and it does not change which receptors a given lot engages.
The C20 fatty diacid attached at position 1 adds substantial mass relative to the unmodified 37-residue backbone, which is why a mass-spectrometry comparison against the lipidated reference mass, rather than against the mass of native amylin, is the correct identity check for this molecule in either packaging format.
Because "Spray" and "vial" describe packaging rather than chemistry, a methods section should still name the molecule precisely by sequence or CAS number, and separately note the catalog format and lot number actually used. This page provides molecular reference information and general research context only, and Veracue provides no dosing, administration or usage guidance of any kind.
Identity and purity for Cagrilintide Spray are established the same way as for any Cagrilintide lot: reverse-phase HPLC for chromatographic purity, and mass spectrometry to confirm that the observed mass matches the molecule’s theoretical lipidated mass. HPLC alone shows that most detected material elutes together; it does not by itself confirm identity, since a closely related or non-lipidated peptide can produce an equally clean trace.
Packaging format has no bearing on which analytical methods apply. A spray-dispensed lot and a vial lot of the same molecule are verified against the same sequence, formula and mass references listed on the Cagrilintide at a Glance table above.
| Method | Tells a researcher | Does not prove by itself |
|---|---|---|
| RP-HPLC | Chromatographic purity (area %) | Identity |
| Mass spectrometry | Mass consistent with lipidated Cagrilintide | Sequence order; purity |
| Net peptide content | Peptide mass versus salts or residual water | Identity of impurities |
| Molecular form declared | Which chemical form the reported data applies to | Purity or identity on its own |
A certificate of analysis describes one lot, never a packaging format or a compound in general. Before relying on any figure, confirm that the lot number on the certificate matches the container and the order record for the spray-format unit received.
A complete certificate separates product identity, lot number, chemical form, HPLC result with method stated, mass spectrometry result with observed and theoretical mass, test date and testing laboratory. Where concentration or fill-volume figures are relevant to a spray-format unit, they are reported on that lot’s own documentation rather than inferred from the catalog listing. The certificate page explains how to request lot documentation for either format.
No. The verification question is the same: does this lot match the stated molecule, and is the purity figure paired with a mass result from the same lot. Packaging format does not change what counts as adequate documentation.
Cagrilintide’s lipidated structure means its reference mass differs substantially from native amylin or from a non-lipidated analogue. If a lot’s documentation leaves the form unstated, any mass-based calculation can carry a silent error. Confirm the form on the lot’s certificate and use the matching reference mass, regardless of packaging format.
For each lot, keep the catalog listing snapshot, the lot-specific certificate, the stated chemical form, the receipt date, labeled storage conditions, and the packaging format actually received. Recording format alongside the usual identity fields keeps multi-format catalogs like this one traceable lot to lot.
Cagrilintide Spray is supplied for laboratory research and analytical characterization only. It is not intended for human or veterinary use, or for ingestion, injection or any form of administration. This page contains no dosing, administration or usage guidance of any kind, and the word "Spray" in the product name describes Veracue’s packaging and dispensing format only. See the Medical Disclaimer and the Terms and Conditions for sitewide policies.
RESEARCH PEPTIDE
Spray bottle pairing a 29-residue GHRH analog with the pentapeptide Ipamorelin, 5 mg of each and 45 sprays per bottle. Laboratory research use only.
RESEARCH PEPTIDE
GLP-T Spray pairs a 39-residue peptide, LY3298176 (CAS 2023788-19-2), with a C20 diacid on lysine 20. 10 to 60 mg, research use only, 45 sprays a bottle.
RESEARCH PEPTIDE
A 28-residue, N-acetylated peptide at 3108.3 g/mol, spray-dispensed in a 10 mg bottle with 45 sprays. Supplied for research use only.
RESEARCH PEPTIDE
Seven residues, a lactam ring and an amide terminus: Melanotan II, CAS 121062-08-6, in a 10 mg bottle of 45 sprays. Laboratory research only.
