Cagrilintide is a synthetic, lipidated analogue of the amylin peptide, coded AM833. Its 37-residue backbone (KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP) carries an intramolecular disulfide bridge and a C20 fatty diacid on the lysine at position 1. Reference values are formula C194H312N54O59S2, about 4,409 g/mol as the free acid, and CAS 1415456-99-3. It is one peptide, so it should not be mixed up with native amylin. Offered as a 10 mg vial, strictly for laboratory research.
Ask for the analytical documentation of any lot.
HPLC is the method used to measure purity
Ask for the report for a specific lot through the contact page
Supplied for laboratory research use only
Mass spectrometry is the method used to confirm identity
Cagrilintide is a synthetic, long-acting analogue of amylin, a pancreatic hormone. It is a 37-amino-acid peptide, carries the development code AM833, and is studied in laboratory systems as a nonselective agonist of amylin receptors and the calcitonin receptor. Veracue supplies it strictly as a research material.
| Product name | Cagrilintide |
| Development code | AM833 |
| Molecular class | Acylated (lipidated) amylin analogue |
| Backbone | 37-amino-acid linear peptide with an intramolecular disulfide bridge |
| Lipid attachment | C20 fatty diacid on the lysine at position 1, through a hydrophilic linker |
| Sequence | KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP |
| Molecular formula | C194H312N54O59S2 (free acid) |
| Molecular weight | About 4,409 g/mol (free acid) |
| CAS Registry Number | 1415456-99-3 |
| Research designation | Research Use Only |
Reference values describe the molecule as recorded in public chemical registries. They are for comparison against a certificate of analysis and are not measurements taken on a specific lot. Physical form, quantity per vial beyond the labelled 10 mg, purity, lot results and storage conditions are reported on each lot’s documentation and can be requested through the contact page.
It is a 37-amino-acid linear peptide based on the native amylin backbone. An intramolecular disulfide bridge, a feature shared across the calcitonin peptide family, sits within the chain. A C20 fatty diacid is attached at the lysine in position 1 through a hydrophilic linker.
The C20 fatty diacid binds reversibly to albumin, and the literature attributes the molecule’s extended persistence in test systems to that binding. This is the same acylation idea used in other long-acting peptides, applied to a different peptide family. It describes how the molecule was designed and is not a handling or preparation instruction.
Amylin is a naturally occurring 37-amino-acid pancreatic peptide. Cagrilintide shares that backbone, but the fatty-diacid conjugation at position 1 and its albumin binding change its behavior in a test system substantially. Research on native amylin explains why Cagrilintide is studied. It is not research on Cagrilintide.
Receptor pharmacology work characterizes Cagrilintide as an agonist across calcitonin-family G protein-coupled receptors, with reported binding at human, mouse and rat amylin receptors. It is commonly described as a dual amylin and calcitonin receptor agonist.
| Item | Detail |
|---|---|
| Receptor systems | Amylin receptors (AMY1 to AMY3) and the calcitonin receptor (CTR) |
| Activity type | Nonselective agonist in receptor assays |
| Receptor family | Calcitonin-family G protein-coupled receptors |
| Species reported in binding work | Human, mouse and rat amylin receptors |
It appears in amylin and calcitonin receptor pharmacology, peptide lipidation and half-life engineering, and the analytical characterization of synthetic peptide analogues.
Receptor pharmacology, structural characterization and laboratory-model work each answer a different question, and a finding from one should not be read across to another. Published studies describe the molecule itself. They do not establish the identity, purity or handling of a specific supplier’s lot.
No. Peptides that use fatty-acid acylation to extend persistence share an engineering strategy, not a mechanism. Cagrilintide acts through amylin and calcitonin receptors, so results from peptides acting on other receptor systems should not be read across to it.
HPLC separates a sample into its component species and reports what proportion of total detected peak area the target compound represents. That is chromatographic purity. It indicates related substances, truncated sequences or counterions, and it does not identify the main peak.
Mass spectrometry measures molecular mass against the theoretical mass for the target sequence, within a stated tolerance. This is what establishes identity. For Cagrilintide the comparison point is a theoretical mass near 4,409 g/mol for the free-acid form. Material supplied as a salt or acetate will differ, which is worth confirming before flagging a mismatch.
A certificate of analysis should carry the product name, lot number, test date, testing laboratory, the specification, and the measured result for each test, with enough method detail to interpret them. A specification is the threshold a batch must meet, while the result is what it measured. A certificate showing only specifications says what was required, not what was found.
Read it in this order.
If any of those five is missing, the document is incomplete, and an incomplete certificate is a fair reason to ask a supplier for more.
No. A label states what a supplier intends to sell, not what is in the vial. Identity is established by measuring molecular mass against the theoretical mass, cross-referenced to CAS 1415456-99-3 and formula C194H312N54O59S2. Ask for the identity result, not the label.
No. HPLC answers how much of a sample is one species. Mass spectrometry answers which species it is. A sample can return a sharp, high-purity peak and still be the wrong compound, so complete documentation reports both together.
Purity and identity vary between production runs. A certificate with no batch number, or one reused across listings and vial sizes, documents a sample rather than your sample. The lot code on the vial should match the lot number on the certificate, and it is best checked on receipt.
A percentage with no method, wavelength, laboratory attribution or underlying chromatogram cannot be independently assessed. Useful documentation names the method, how purity was calculated, the technique used for mass spectrometry, the laboratory and the date.
Not always. Registries hold records for salt and related forms as well as the free acid, so confirm which form a database entry or certificate refers to before comparing numbers.
This checklist applies to any supplier.
Purity results, identity results, physical form and storage conditions are reported on the documentation for each lot. Ask the Veracue team for the documentation on a specific lot, or review the certificate archive.
Cagrilintide is supplied for laboratory research use only and is not intended for human or veterinary use, ingestion, injection, diagnosis or treatment. It has not been evaluated by the FDA. This page provides no dosing, administration or usage guidance of any kind. See the Medical Disclaimer and the Terms and Conditions for sitewide policies.
RESEARCH PEPTIDE
Not a peptide: 5-Amino-1MQ is a quinolinium cation, C10H11N2+ (159.21 g/mol); its iodide salt is 286.11. Check the form. Laboratory research, 50 mg.
RESEARCH PEPTIDE
GLP-S is a 31-residue GLP-1 analog with a C18 diacid on lysine 26 (C187H291N45O59, CAS 910463-68-2). Available from 5 to 30 mg, research use only.
RESEARCH PEPTIDE
Is H-Frag just AOD 9604 under another name? No. It opens with Phe, not Tyr, and weighs 1799.1 g/mol (CAS 66004-57-7). A 5 mg vial for laboratory research.
RESEARCH PEPTIDE
GLP-T (LY3298176) is a 39-residue peptide with a C20 fatty diacid, CAS 2023788-19-2. See the COA notes. 10 to 60 mg, research use only.
