# VIP

> Research use only. Not for human or veterinary use. Supplied by Veracue Labs.

- Page: https://veracuelabs.com/product/vip
- Category: Healing & Recovery
- Sizes and prices in USD: 10 mg at $82.49
- Certificate of analysis: none posted on the page. Request one for a specific lot at https://veracuelabs.com/contact-us.
- Prices are a snapshot from 2026-10-17. The product page shows the current price.

## Overview

VIP is vasoactive intestinal peptide, a linear 28-residue neuropeptide with the sequence HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 and an amidated C-terminus. Reference values are formula C147H238N44O42S, average mass about 3325.8 g/mol and CAS 40077-57-4. Human, porcine and rat VIP share this one sequence. It sits in the same peptide superfamily as PACAP, secretin and glucagon yet differs from each in sequence and mass. Veracue supplies VIP as a 10 mg vial, strictly for laboratory research use only.

## Product Details

### What Is VIP?

VIP stands for vasoactive intestinal peptide, a neuropeptide of 28 amino acids first isolated from hog small intestine in 1970 and also written vasoactive intestinal polypeptide. In one-letter code the sequence is HSDAVFTDNYTRLRKQMAVKKYLNSILN, and the chain ends in an amide rather than a free carboxylic acid. Reference sources list a single sequence for human, porcine and rat VIP, so a record labeled for any of the three describes the same chain.

VIP is one defined peptide. It is not a blend, and it is not any of the neighboring peptides it is often listed beside in search results. Veracue supplies it for research use only.

### VIP at a Glance

Product name: VIP (vasoactive intestinal peptide, also vasoactive intestinal polypeptide)
Molecule type: Synthetic linear peptide, 28 residues, C-terminal amide
Sequence (one-letter): HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
Sequence (three-letter): His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
Molecular formula (free peptide): C147H238N44O42S
Molecular weight (average): About 3325.8 g/mol
CAS Registry Number: 40077-57-4
Receptor context: VPAC1 and VPAC2, at assay level
Size offered: 10 mg vial
Research designation: Research Use Only

Formula, mass and CAS number are reference values for the free peptide, not a Veracue lot result. The chemical form (free peptide or a salt), purity, lot number and storage conditions for a particular vial are reported on its own documentation, which you can request through the contact page.

### What VIP Is Not

- Not PACAP. PACAP is a separate peptide that shares the VPAC1 and VPAC2 receptors with VIP and also has a receptor of its own.
- Not secretin, glucagon, GIP or growth hormone-releasing hormone. They are relatives in the same superfamily, each with its own sequence.
- Not PHM or PHV. These peptides come from the same precursor protein as VIP but have different sequences.
- Not a consumer, dietary or cosmetic product.
- Not intended for human or veterinary use.

## Research Focus & Mechanism Overview

### Molecular Identity

### What does the VIP sequence contain?

The 28 residues of HSDAVFTDNYTRLRKQMAVKKYLNSILN break down into three each of asparagine, leucine and lysine, two each of serine, aspartic acid, alanine, valine, threonine, tyrosine and arginine, and one each of histidine, phenylalanine, glutamine, methionine and isoleucine. Five side chains are basic (three lysines and two arginines) against two acidic aspartates, there is no glutamate, and the amidated C-terminus carries no carboxylate, so the peptide is net positive at neutral pH.

### Why does the single methionine matter?

VIP has one methionine, at position 17, and no cysteine, so there are no disulfide bonds to account for. Methionine oxidizes readily, and an oxidized chain runs about 16 Da heavier than the intended one. There is no tryptophan; the aromatic residues are phenylalanine at position 6 and tyrosines at positions 10 and 22.

### Why do VIP, VIP peptide and vasoactive intestinal polypeptide all appear?

They are different ways of writing one peptide. Suppliers label it loosely, and the receptor gene symbols VIPR1 and VIPR2 turn up in the same searches, so the sequence, formula and CAS number are a safer test of identity than the name.

### VIP and Its Look-Alikes

VIP belongs to a superfamily of structurally related peptide hormones, and neighbors in that family are easy to confuse on supplier lists. The table covers identity and receptor context only.

Feature: VIP: PACAP

Relationship: Reference molecule for this listing: Separate peptide in the same superfamily
VPAC1 and VPAC2: Bound with high affinity: Bound with high affinity
PAC1: Not the preferred ligand: Selective ligand
Identity check: 28-residue sequence, amidated C-terminus, about 3325.8 g/mol: Different sequence and mass; verify against its own records

Secretin and glucagon belong to the same superfamily, and helodermin, a relative first reported from lizard venom, is sometimes grouped with them. Because family members have related sequences, a name match is never enough. Confirm the 28-residue chain and the observed mass against the reference values for VIP itself.

### Receptor Context at Assay Level

VIP acts through class B G protein-coupled receptors, the secretin-receptor-like family. The IUPHAR naming recognizes three: VPAC1 and VPAC2, which bind both VIP and PACAP with high affinity, and PAC1, which is selective for PACAP. In cell-based work VIP is used as a reference ligand in binding and signaling assays, commonly with a cyclic AMP readout.

Which receptor produces a given signal depends on the subtypes a cell line expresses, so assay design has to account for both the ligand and the receptor population. Veracue offers molecular reference information here and provides no dosing, administration or usage guidance of any kind.

## Quality & Purity Standards

### Analytical Characterization

Reverse-phase HPLC reports chromatographic purity, the share of detected signal that sits in the main peak, but it cannot say which molecule that peak is. Mass spectrometry supplies the identity check by comparing the measured mass with the expected one.

At about 3325.8 g/mol, VIP is large enough that electrospray mass spectrometry shows it as a series of multiply charged ions rather than one peak at the neutral mass. On an average-mass basis the 3+ ion falls near m/z 1109.6, the 4+ ion near 832.5 and the 5+ ion near 666.2. Convert each observed m/z back to a neutral mass by multiplying by the charge and subtracting one proton per charge, and every peak should land on the same figure. MALDI-TOF mostly shows the singly charged ion instead, near m/z 3326.9.

Monoisotopic readings, which many high-resolution instruments report, sit about 2 Da below the average-mass figure, so compare like with like.

Method: Tells a researcher: Does not prove by itself

RP-HPLC: Chromatographic purity (area %) under stated conditions: Identity or net peptide content
ESI-MS or MALDI-TOF: Measured mass against the expected value for VIP: Purity or amino acid order
Tandem MS: Fragment evidence for the sequence: Overall purity or quantity
Amino acid analysis: Net peptide content: Identity of impurities

### What a Mass Result Can and Cannot Separate

Some VIP variants sit very close to the target. A free-acid C-terminus or a deamidated asparagine shifts the mass by only about 1 Da, which low-resolution instruments may not resolve, so HPLC retention and the stated method matter alongside the mass. Methionine oxidation is easier to spot, at roughly +16 Da.

### How to Read a VIP Certificate of Analysis

A certificate describes one lot, not the compound in general, so begin by matching the lot number on the document with the vial and your order record.

A complete VIP certificate names the product and its chemical form, because a salt such as trifluoroacetate or acetate adds counterion weight and changes any mass-based calculation. It should give an HPLC result with its method and chromatogram, a mass result stating observed and expected mass on a named convention, net peptide content, the test date and the testing laboratory. Results and storage conditions are reported on each lot’s own documentation, and the certificate page explains how to request it.

### Common Questions About Verification

### Does a high purity figure prove the vial contains VIP?

No. A single sharp peak shows that most of the detected material behaves alike, not that it is VIP. Pair the purity figure with a mass result from the same lot.

### Why ask for net peptide content as well?

Purity describes the peptide-related signal, while net peptide content describes how much of the vial mass is peptide rather than counterion, salt or water. The two figures answer different questions.

### What should be compared first when a certificate arrives?

Check the lot number against the vial label, then the stated chemical form, then the observed mass against 3325.8 g/mol read on the same convention. Only when those three agree is the purity figure worth interpreting.

### Documentation for a Specific VIP Lot

Ask the Veracue team what documentation exists for the lot you are considering, or browse the certificate library.

- Request lot documentation
- View certificates
- Browse the research catalog

## Compliance Notice

### Research Use Only Notice

VIP is sold for laboratory research and analytical characterization. The material is not intended for human or veterinary use, for ingestion, injection or any other form of administration, and it is not a drug, dietary supplement, cosmetic or food. Veracue provides no dosing, administration or usage guidance of any kind. Purchasers must be qualified researchers or institutions and are responsible for handling the material lawfully. The Medical Disclaimer and the Terms and Conditions set out sitewide policies.

## Questions and answers

### What is VIP?

VIP is vasoactive intestinal peptide, a synthetic 28-amino-acid neuropeptide with an amidated C-terminus, also written vasoactive intestinal polypeptide. Veracue supplies it for laboratory research use only.

### What is the VIP sequence?

It is HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, 28 residues in total, or His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 in three-letter code.

### What are the molecular formula and weight of VIP?

The free peptide is C147H238N44O42S with an average mass of about 3325.8 g/mol. A salt form has a higher formula weight because the counterion adds mass.

### What is the CAS number for VIP?

The CAS Registry Number is 40077-57-4, the number reference suppliers list for human, porcine and rat VIP.

### Does the human, porcine or rat label change the VIP sequence?

No. Reference sources list one identical 28-residue sequence for all three, so the species label does not change the molecule.

### Is VIP the same as PACAP?

No. PACAP is a separate peptide in the same superfamily that shares the VPAC1 and VPAC2 receptors with VIP and also has a receptor of its own, PAC1.

### What does vasoactive intestinal peptide mean?

The name joins the tissue it was first isolated from, hog small intestine in 1970, with an early observation of activity on blood vessels. VIP is the standard abbreviation.

### Why does the C-terminal amide matter for VIP?

The amide and free-acid forms differ by only about 1 Da, so a record that leaves out the amide can describe a different species while looking almost identical in mass.

### Which VIP residue is prone to oxidation?

The single methionine at position 17. An oxidized species appears about 16 Da above the expected mass.

### What are VPAC1 and VPAC2?

They are class B G protein-coupled receptors that bind VIP and PACAP with high affinity. A third receptor, PAC1, is selective for PACAP.

### Why do VIPR1 and VIPR2 appear in searches for VIP?

They are the gene symbols for the VPAC1 and VPAC2 receptors, not peptides. Searching both the receptor names and the gene symbols finds more of the literature.

### How should the mass of a VIP lot be compared with the reference value?

Convert any electrospray m/z back to a neutral mass using its charge state, and compare on the same convention the method reports, average or monoisotopic. At about 3325.8 g/mol the 4+ ion falls near m/z 832.5.

### Does a high HPLC purity prove a vial contains VIP?

No. HPLC shows how much of the signal sits in one peak, not which molecule it is, so it needs a mass result from the same lot beside it.

### What size does Veracue offer?

VIP is offered as a 10 mg vial, supplied for laboratory research use only.

### What does Research Use Only mean?

It means the material is supplied only for laboratory research and analysis, not for human or veterinary use, ingestion, injection or any other form of administration.

### Does Veracue provide usage instructions for VIP?

No. VIP is offered for laboratory research use only, and Veracue provides no dosing, administration or usage guidance of any kind.

More from Veracue Labs: https://veracuelabs.com/llms.txt