# GLP-S Spray

> Research use only. Not for human or veterinary use. Supplied by Veracue Labs.

- Page: https://veracuelabs.com/product/glp-s-spray
- Category: Nasal Sprays
- Sizes and prices in USD: 5 mg at $76.99; 10 mg at $93.49; 20 mg at $120.99; 30 mg at $148.49
- Certificate of analysis: none posted on the page. Request one for a specific lot at https://veracuelabs.com/contact-us.
- Prices are a snapshot from 2026-10-17. The product page shows the current price.

## Overview

GLP-S Spray is the spray-dispensed form of GLP-S, a lipidated analog of GLP-1(7-37). Its 31-residue chain, HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG, carries aminoisobutyric acid at position 8 and an acylated lysine at position 26. Reference values are formula C187H291N45O59, average mass about 4113.58 g/mol and CAS 910463-68-2, with the C18 diacid side chain accounting for the mass above the bare backbone.

## Product Details

### GLP-S Spray at a Glance

Product name: GLP-S Spray
Format: Spray-dispensed bottle, 45 sprays per bottle
Sizes offered: 5 mg, 10 mg, 20 mg and 30 mg
Peptide: GLP-S, a lipidated 31-residue analog of GLP-1(7-37)
Chain: HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG, numbered 7 to 37, with Aib at position 8 (written as A) and arginine at position 34
Acyl group on lysine 26: C18 diacid joined through a gamma-glutamic acid and two-unit OEG spacer
Molecular formula: C187H291N45O59
Average mass: About 4113.58 g/mol
Monoisotopic mass: 4111.1154 Da
CAS Registry Number: 910463-68-2
PubChem CID: 56843331
Receptor target: GLP-1 receptor, agonist in receptor assays
Research designation: Research Use Only

Formula and masses are calculated reference figures for the acylated peptide, not Veracue lot results.

### The Peptide in GLP-S Spray

The active material is GLP-S, a 31-residue peptide that tracks the human GLP-1(7-37) sequence except at two positions and bears an acyl chain on its one lysine. Veracue offers it in a spray-dispensed bottle with 45 sprays, at four strengths, for laboratory research use only.

For salt form, purity and lot-level results, use the contact page to request the documentation for your lot.

### Easy Mix-Ups to Avoid

- The bare 31-residue backbone without its acyl chain. It lacks the side chain and reads at a much lower mass.
- Lipidated analogs that carry a shorter fatty acid and no OEG spacer. Here the acyl group is a C18 diacid on a gamma-glutamic acid and two-OEG spacer.
- Multi-receptor peptides. GLP-S is treated as a single-receptor agonist at the GLP-1 receptor.
- Consumer, dietary or cosmetic products. GLP-S Spray is not intended for human or veterinary use.

## Research Focus & Mechanism Overview

### Reading the Structure Piece by Piece

Part: Where: What it is

Peptide chain: Positions 7 to 37 of GLP-1 numbering: 31 residues, 29 of them identical to native GLP-1(7-37)
Aib: Position 8: Aminoisobutyric acid in place of alanine, which blocks DPP-4 cleavage
Arginine: Position 34: Replaces the native lysine, leaving lysine 26 as the only lysine
Acylated lysine: Position 26: Carries the side chain on its amine
Spacer: Between lysine and diacid: Gamma-glutamic acid plus two OEG units (8-amino-3,6-dioxaoctanoic acid, also written AEEA)
Fatty diacid: End of the side chain: Octadecanedioic acid, a C18 diacid that binds albumin reversibly
C-terminus: Position 37: Free acid

Counting the residues gives one histidine, one tryptophan and two arginines, and no cysteine or methionine. There are therefore no disulfide bridges and no methionine oxidation to track, which leaves the side chain as the main structural feature to verify.

### The GLP-1 Receptor in Assays

GLP1R is the receptor GLP-S is built to engage, a class B (secretin-like) G protein-coupled receptor that also binds native GLP-1. Binding and signaling studies in receptor assays are the usual setting, and the engineered changes bear on stability and albumin association, not on which receptor is engaged.

Because the diacid binds albumin reversibly, whether albumin is present in an assay system is worth recording next to the lot number. This is a note on interpreting results, not a handling or preparation instruction.

### Common Questions on Identity

### How much of GLP-S is native GLP-1 sequence?

Twenty-nine of 31 residues, about 94 percent. The differences sit at positions 8 and 34 and in the acyl group, and together they change the formula, mass and CAS number.

### Why does the acyl group matter for verification?

It adds a spacer and a C18 diacid to lysine 26, so a correct lot reads near 4.1 kDa. A result near the mass of the bare backbone points to a lost side chain and should not be read as a match.

## Quality & Purity Standards

### Charge-State Reference for GLP-S

A peptide of 4113.58 g/mol seldom appears at its neutral mass in electrospray MS. It carries several charges at once, and the table gives the calculated m/z for the first four, derived from the monoisotopic mass of 4111.1154 Da with one proton mass added per charge.

Charge state: Calculated m/z

[M+2H]2+: 2056.56
[M+3H]3+: 1371.38
[M+4H]4+: 1028.79
[M+5H]5+: 823.23

These are formula-derived reference values, not Veracue lot results. An average-mass reading sits a little higher than a monoisotopic one, which is why any report has to say which convention it follows.

### What Each Check Can Tell You

- Reversed-phase HPLC: the diacid raises retention compared with the bare backbone, so gradient and column decide how well intact GLP-S separates from forms that lost the side chain. It gives purity under stated conditions, not identity.
- Intact-mass MS: tests whether the observed mass fits the acylated molecule. It cannot separate a sequence-scrambled isomer of the same composition or detect D-amino-acid forms.
- Tandem MS or Edman-type sequencing: residue order across the backbone, plus fragment evidence for where the side chain sits.
- Chiral amino acid analysis: D-isomer content, which intact mass cannot see.
- Amino acid and counterion analysis: net peptide content and the share of the material that is salt.

### Reading a Lot Record for a GLP-S Spray Bottle

A record covers one lot. Confirm that its lot number matches the bottle label, that the expected mass is stated with its convention, and that the identity result speaks to the side chain and not only the backbone. A purity percentage should name its method.

- Lot number matches the bottle
- Formula and expected mass given, monoisotopic or average
- Purity percentage with a named method
- Observed mass with the charge states used
- Laboratory name and test date

Lot documentation can be requested as described on the certificate page.

### Want lot documentation for GLP-S Spray?

Contact the Veracue team about a specific lot, or look through the certificate library.

- Request lot documentation
- View certificates
- See the full catalog

## Compliance Notice

### Research Use Only Statement

GLP-S Spray is offered for laboratory research only. It is not meant for human or veterinary use, and it is not a drug, supplement, food or cosmetic. The FDA has not evaluated it. Veracue gives no dosing, administration or usage guidance of any kind, and the science described here is laboratory-level information, not medical advice. Sitewide policies are in the Medical Disclaimer and the Terms and Conditions.

### Qualified Purchasers

Buyers are expected to be qualified researchers or institutions, and to work with the material in line with all applicable laws.

### Records Follow the Lot

Analytical results describe the lot that was tested and nothing else. Note the lot number from the bottle label alongside every experiment that uses the material.

## Questions and answers

### What is GLP-S Spray?

GLP-S Spray is a spray-dispensed research format of GLP-S, a 31-residue lipidated GLP-1 analog peptide with a C18 diacid on lysine 26. Veracue supplies it for laboratory research use only.

### How many sprays are in each bottle?

Each bottle holds 45 sprays. Bottles come in 5, 10, 20 and 30 mg sizes.

### Which formula and mass describe GLP-S?

The formula is C187H291N45O59, with an average mass of about 4113.58 g/mol and a monoisotopic mass of 4111.1154 Da, both calculated from the formula.

### Which CAS number and PubChem ID apply?

CAS 910463-68-2 and PubChem CID 56843331.

### How does GLP-S differ from native GLP-1?

Two backbone positions change, with Aib at 8 and arginine at 34, and lysine 26 carries a spacer and C18 diacid. The result is a distinct molecule with its own formula, mass and CAS number.

### What is the side chain made of?

A gamma-glutamic acid and two OEG units (8-amino-3,6-dioxaoctanoic acid) connect lysine 26 to octadecanedioic acid, a C18 fatty diacid. Some documents write OEG as AEEA.

### Why is there only one acylation site?

The chain contains a single lysine, at position 26, because position 34 holds arginine instead of the native lysine.

### Which receptor does GLP-S target?

The GLP-1 receptor, a class B G protein-coupled receptor. Assays treat GLP-S as a single-receptor agonist.

### What m/z values should a GLP-S mass spectrum show?

Calculated from the monoisotopic mass, the 2+ ion falls near 2056.56, 3+ near 1371.38, 4+ near 1028.79 and 5+ near 823.23. A deconvoluted result should land near 4111.12 Da monoisotopic or 4113.58 average.

### Can intact-mass MS alone confirm GLP-S?

No. It cannot tell a sequence-scrambled variant of the same composition from the correct molecule, and it cannot detect D-amino-acid isomers. Fragmentation data and chiral amino acid analysis cover those gaps.

### What should a GLP-S Spray lot record contain?

A lot number that matches the bottle, the formula and expected mass with their convention, a purity figure with its method, an observed mass with charge states, and the laboratory and test date.

### What does Research Use Only mean for this item, and is guidance provided?

It means the material is for laboratory research, not for human or veterinary use, and the FDA has not evaluated it. Veracue gives no dosing, administration or usage guidance of any kind.

More from Veracue Labs: https://veracuelabs.com/llms.txt