# CJC/Ipamorelin > Research use only. Not for human or veterinary use. Supplied by Veracue Labs. - Page: https://veracuelabs.com/product/cjc-ipamorelin - Category: Growth Hormone Secretagogue - Sizes and prices in USD: 5 mg / 5 mg at $76.99 - Certificate of analysis: none posted on the page. Request one for a specific lot at https://veracuelabs.com/contact-us. - Prices are a snapshot from 2026-10-16. The product page shows the current price. ## Overview CJC/Ipamorelin is a two-peptide research blend of CJC-1295 No DAC and Ipamorelin, 5 mg of each. CJC-1295 No DAC, also called Mod GRF 1-29, is a 29-residue growth hormone-releasing hormone analog, YADAIFTQSYRKVLAQLSARKLLQDILSR-NH2 with D-alanine at position 2 (C152H252N44O42, average mass about 3367.9 g/mol, CAS 863288-34-0 and 446036-97-1). Ipamorelin is the pentapeptide Aib-His-D-2-Nal-D-Phe-Lys-NH2 (C38H49N9O5, about 711.85 g/mol, CAS 170851-70-4), studied at the ghrelin receptor rather than the GHRH receptor. ## Product Details ### What Is CJC/Ipamorelin? CJC/Ipamorelin is the label for one vial that holds two separate peptides, CJC-1295 No DAC and Ipamorelin, rather than a single molecule. They share no sequence and no receptor, which is why every identifier below is listed per component. The label carries the name followed by two numbers, and 5/5 mg means 5 mg of each peptide. The CJC half is the 29-residue form with no DAC group. DAC stands for Drug Affinity Complex, a lysine-linked maleimidopropionyl group that belongs to a different compound, and this molecule ends at residue 29 without it. Chemists also write this half as Mod GRF 1-29, modified GRF(1-29) or tetrasubstituted GRF(1-29), and sellers use CJC-1295 without DAC or W/O DAC. The other half, Ipamorelin, is a short synthetic chain built partly from non-standard residues. Veracue supplies the vial for research use only. ### CJC/Ipamorelin at a Glance Product name: CJC/Ipamorelin (CJC-1295 No DAC plus Ipamorelin; also written CJC Ipamorelin blend) Components: Two separate peptides in one vial Label strength: 5/5 mg (5 mg of each peptide) CJC-1295 No DAC: 29 residues, C-terminal amide, C152H252N44O42, average mass about 3367.9 g/mol, CAS 863288-34-0 (446036-97-1 is also listed for this peptide) CJC-1295 No DAC changes from native GHRH(1-29): D-Ala2, Gln8, Ala15, Leu27 Ipamorelin: 5 residues, C38H49N9O5, average mass about 711.85 g/mol, CAS 170851-70-4 Size offered: One size, the 5/5 mg vial Research designation: Research Use Only Formula, mass and registry numbers are reference values for the free peptides and are not lot results. Chemical form, physical form, purity and storage questions for a particular vial belong in a documentation request, and documentation can be requested through the contact page. ### Look-Alikes to Rule Out - CJC-1295 with DAC, a 30-residue compound with a lysine-linked maleimidopropionyl group, C165H269N47O46, about 3647.2 g/mol and CAS 446262-90-4. - Sermorelin, the unmodified GHRH(1-29) amide, C149H246N44O42S, about 3357.9 g/mol and CAS 86168-78-7. - A single-peptide vial of CJC-1295 No DAC or of Ipamorelin, each of which holds only one of the two components. - Any consumer, dietary or cosmetic product. The vial is not intended for human or veterinary use. ## Research Focus & Mechanism Overview ### The Two Components ### CJC-1295 No DAC (Mod GRF 1-29) Residues read Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2, or YADAIFTQSYRKVLAQLSARKLLQDILSR-NH2 in one-letter code. Set beside native GHRH(1-29), four positions differ: D-alanine replaces L-alanine at 2, glutamine replaces asparagine at 8, alanine replaces glycine at 15 and leucine replaces methionine at 27. Together they add three CH2 groups and remove the only sulfur atom, which is how the formula ends up at C152H252N44O42. ### Ipamorelin Ipamorelin is the five-residue chain Aib-His-D-2-Nal-D-Phe-Lys-NH2 with a C-terminal amide. Three of its five residues are non-standard or D-configured: aminoisobutyric acid (Aib), D-2-naphthylalanine and D-phenylalanine. Together with its short length, that makes it structurally unrelated to anything in the GHRH family. ### Side by Side Feature: CJC-1295 No DAC: Ipamorelin Length: 29 residues: 5 residues Molecular formula: C152H252N44O42: C38H49N9O5 Average mass: About 3367.9 g/mol: About 711.85 g/mol CAS Registry Number: 863288-34-0 (446036-97-1 also listed): 170851-70-4 Notable chemistry: D-Ala2 plus Gln8, Ala15 and Leu27 changes to the native GHRH(1-29) chain: Aib, D-2-Nal and D-Phe residues Receptor studied: GHRH receptor: Ghrelin receptor (GHS-R1a) Signaling context: Adenylyl cyclase and cAMP: Phospholipase C and calcium The masses sit about 2656 Da apart, 3367.9 against 711.85, so the two components cannot be mistaken for each other in a mass reading. ### Two Receptors, Two Pathways CJC-1295 No DAC is studied at the GHRH receptor, a G protein-coupled receptor on pituitary somatotroph cells that signals mainly through adenylyl cyclase and cyclic AMP. Ipamorelin is studied as an agonist at GHS-R1a, the ghrelin receptor, whose signaling runs mainly through phospholipase C and calcium. Different receptors and different second-messenger routes mean that a finding about one peptide says nothing on its own about the other, or about the pair. A result obtained with one component alone does not describe the mixture, and this listing describes no combined effect. Everything here is molecular reference material, with no dosing, administration or usage guidance of any kind attached to it. ### Reading Published Work on CJC-1295 The bare name CJC-1295 was first attached to the albumin-binding compound, and the No DAC and without DAC tags came later for the 29-residue chain. When a paper or supplier sheet says only CJC-1295, check the methods for the structure or the CAS number. The 29-residue peptide in this vial is 863288-34-0, with 446036-97-1 also listed, while the DAC-bearing compound is 446262-90-4, and findings reported for one should not be carried over to the other. ## Quality & Purity Standards ### What a Mass Reading Should Show for Each Peptide Peptides rarely appear at their neutral mass in electrospray spectra. They show as multiply charged ions, and the table gives calculated m/z values on an average-mass basis, taken as the reference mass plus one proton per charge. Component: Average mass (g/mol): Ions to look for (m/z) CJC-1295 No DAC: About 3367.9: 3+ near 1123.6, 4+ near 843.0, 5+ near 674.6 Ipamorelin: About 711.85: 1+ near 712.9, 2+ near 356.9 A sample of the mixture should show both sets of peaks, and a spectrum with only one of them would suggest a component is missing. Sodium or potassium adducts push peaks to higher m/z, so work back from an observed ion to a neutral mass before checking it against the numbers above. ### Mass Gaps to the Look-Alikes Compound: Average mass (g/mol): Gap to CJC-1295 No DAC: 4+ ion (m/z) CJC-1295 No DAC: About 3367.9: None: 843.0 CJC-1295 with DAC: About 3647.2: About 279 Da heavier: 912.8 Sermorelin: About 3357.9: About 10 Da lighter: 840.5 A CJC signal near 3647 would point to the DAC-bearing compound, which is far enough away to be obvious. Sermorelin is the harder one, only 10 Da lower and about 2.5 units of m/z at 4+, so telling it from the No DAC peptide needs a calibrated instrument with adequate resolution. ### Documentation for a Two-Peptide Product Lot documentation describes one lot, so match its lot number to the vial before reading anything else. For a blend, a single purity figure or a single mass is not enough. Useful items to look for are an identity result for each peptide, a stated amount of each, the chemical form, the test date and the laboratory behind it. A combined purity figure can hide a shortfall in one component while the other looks clean. Anyone who wants that paperwork for a particular vial can ask through the contact page. ### Questions About Checking a Combined Vial ### Does one clean chromatographic peak show that both peptides are present? No. A blend should give a separate peak for each peptide, and even then the retention time does not say which molecule each peak is. Identity comes from a mass result for each component. ### Why is the D-configuration hard to confirm? D and L forms of an amino acid have identical mass, so a spectrum cannot separate them. D-alanine at position 2 of the CJC peptide adds no atoms, and the D-2-Nal and D-Phe residues of Ipamorelin behave the same way, so confirming them takes chiral amino acid analysis or comparison with a reference standard. ### What is worth keeping in a record for each vial? Save the listing text as it read on the day of purchase, the label strength, any documentation received and the date the vial arrived, along with the experiments that used it. That makes an unexpected result easy to trace. ### Questions about a vial? - Ask the Veracue team about documentation - Browse the research catalog ## Compliance Notice ### Research Use Only Notice CJC/Ipamorelin vials hold research material, sold for laboratory work and analytical characterization. The contents are not for human or veterinary use, are not a drug, dietary supplement, cosmetic or food, and must not be ingested, injected or otherwise administered. The listing contains no dosing, administration or usage guidance of any kind. Purchasers are expected to be qualified researchers or institutions, and lawful handling is their responsibility. Policies that apply across the whole site are in the Medical Disclaimer and the Terms and Conditions. ## Questions and answers ### What is in a CJC/Ipamorelin vial? Two separate peptides: CJC-1295 No DAC, a 29-residue GHRH(1-29) analog also called Mod GRF 1-29, and Ipamorelin, the pentapeptide Aib-His-D-2-Nal-D-Phe-Lys-NH2. Veracue supplies the vial for laboratory research only. ### What does 5/5 mg on the label mean? The label gives a figure for each peptide, so 5/5 mg means 5 mg of CJC-1295 No DAC and 5 mg of Ipamorelin. The name alone does not state an amount. ### Which form of CJC-1295 is in this vial? The No DAC form, the 29-residue peptide with D-Ala2, Gln8, Ala15 and Leu27. CJC-1295 with DAC is a separate 30-residue compound near 3647.2 g/mol with CAS 446262-90-4, and it is not what the vial holds. ### What does No DAC mean? DAC is the Drug Affinity Complex, a lysine-linked maleimidopropionyl group that a different compound carries after residue 29. No DAC means the chain stops at residue 29 with no such group. ### What are the formula, mass and CAS number of the CJC-1295 component? C152H252N44O42, an average mass of about 3367.9 g/mol for the free peptide, and CAS 863288-34-0, with 446036-97-1 also listed. Salt forms weigh more than the free peptide. ### What are the formula, mass and CAS number of Ipamorelin? C38H49N9O5, an average mass of about 711.85 g/mol, and CAS 170851-70-4. Its sequence is Aib-His-D-2-Nal-D-Phe-Lys-NH2. ### Which four residues of the CJC peptide differ from native GHRH(1-29)? Position 2 is D-alanine instead of L-alanine, position 8 is glutamine instead of asparagine, position 15 is alanine instead of glycine and position 27 is leucine instead of methionine. ### Can a mass reading tell the two peptides apart? Yes, easily. CJC-1295 No DAC sits near 3367.9 g/mol and Ipamorelin near 711.85, a gap of about 2656 Da, so their ions appear in different parts of the spectrum. ### Do the two peptides share a receptor? No. CJC-1295 No DAC is studied at the GHRH receptor, which signals mainly through cAMP, and Ipamorelin is studied at the ghrelin receptor GHS-R1a, which signals mainly through phospholipase C and calcium. ### Does research on one peptide describe the pair? Not on its own. A result with CJC-1295 No DAC alone or Ipamorelin alone describes that compound under those conditions, and this listing describes no combined effect. ### What would a CJC mass near 3647 or near 3358 suggest? A reading near 3647 fits the DAC-bearing compound and one near 3358 fits Sermorelin. Either would mean the CJC peptide is not the No DAC form, or that the chemical form needs reconciling with the paperwork. ### What should documentation for a two-peptide vial include? An identity result and an amount for each peptide, the chemical form, a lot number matching the vial, the test date and the laboratory. A single combined figure says little about either component. ### How do I request documentation for a vial? Documentation can be requested through the contact page, and the Veracue team will say what is available for the product you are asking about. ### What does Research Use Only mean for this vial? It limits the contents to laboratory research and analysis. The vial is not for human or veterinary use and is not meant to be ingested, injected or administered in any way. ### Is any usage guidance supplied with the vial? No. The listing contains no dosing, administration or usage guidance of any kind, because the vial is sold for laboratory research only. More from Veracue Labs: https://veracuelabs.com/llms.txt