# CJC/Ipamorelin Spray

> Research use only. Not for human or veterinary use. Supplied by Veracue Labs.

- Page: https://veracuelabs.com/product/cjc-ipamorelin-spray
- Category: Nasal Sprays
- Sizes and prices in USD: 5 mg / 5 mg at $93.49
- Certificate of analysis: none posted on the page. Request one for a specific lot at https://veracuelabs.com/contact-us.
- Prices are a snapshot from 2026-10-16. The product page shows the current price.

## Overview

CJC/Ipamorelin Spray is a spray-dispensed pairing of two unrelated peptides. The first, CJC-1295 No DAC (Mod GRF 1-29), is a tetrasubstituted analog of the first 29 residues of growth hormone-releasing hormone, with D-alanine at position 2, the formula C152H252N44O42, an average mass near 3367.9 g/mol and CAS 863288-34-0. The second, Ipamorelin, is a five-residue synthetic chain, Aib-His-D-2-Nal-D-Phe-Lys-NH2, with the formula C38H49N9O5, an average mass near 711.85 g/mol and CAS 170851-70-4.

## Product Details

### Spray Bottle Snapshot

Product name: CJC/Ipamorelin Spray (CJC-1295 No DAC plus Ipamorelin)
Packaging: 45 sprays per bottle, spray-dispensed
Label strength: 5/5 mg, with 5 mg of each peptide
CJC-1295 No DAC sequence: YADAIFTQSYRKVLAQLSARKLLQDILSR-NH2, with D-alanine at position 2
CJC-1295 No DAC formula and mass: C152H252N44O42, average mass about 3367.9 g/mol
CJC-1295 No DAC CAS Registry Number: 863288-34-0 (446036-97-1 is also listed)
Ipamorelin sequence: Aib-His-D-2-Nal-D-Phe-Lys-NH2
Ipamorelin formula and mass: C38H49N9O5, average mass about 711.85 g/mol
Ipamorelin CAS Registry Number: 170851-70-4
Research designation: Research Use Only

Fill volume, concentration and the carrier liquid are not part of the listing data, and documentation can be requested through the contact page for anyone who needs them.

### The Two Peptides Inside the Bottle

One bottle holds two chemically unrelated peptides. CJC-1295 No DAC is a long chain that follows the first 29 residues of growth hormone-releasing hormone (GHRH), while Ipamorelin is a five-residue chain with no sequence relationship to GHRH at all. The product name packs both into one shorthand, so the identity data on this listing is kept separate for each.

The 5/5 mg on the label gives one figure per peptide, so a bottle carries 5 mg of the CJC peptide and 5 mg of Ipamorelin. The 45-spray count is a packaging count, and nothing on this listing states how much peptide a single spray delivers.

### Which CJC-1295 Is in the Bottle?

The name CJC-1295 is used for two different compounds that share one 29-residue backbone. The bottle holds the shorter one, the No DAC peptide, which stops at residue 29 and is also sold as Mod GRF 1-29. The other compound adds a single lysine that carries a maleimidopropionyl group known as the Drug Affinity Complex (DAC).

Feature: No DAC (in this bottle): With DAC (a different compound)

Residues: 29: 30
Molecular formula: C152H252N44O42: C165H269N47O46
Average mass: About 3367.9 g/mol: About 3647.2 g/mol
CAS Registry Number: 863288-34-0 (446036-97-1 is also listed): 446262-90-4
Added group: None: Maleimidopropionyl on a C-terminal lysine

A measured mass near 3368 g/mol fits the No DAC peptide, while a reading near 3647 g/mol would point to the other compound.

### Ipamorelin in the Bottle

Ipamorelin is a synthetic chain of five residues, Aib-His-D-2-Nal-D-Phe-Lys-NH2, closed with a C-terminal amide. Aminoisobutyric acid (Aib) and D-2-naphthylalanine are not among the twenty standard amino acids, and the phenylalanine is the D isomer, so histidine and lysine are the only standard L-amino acids in the chain. Its formula is C38H49N9O5 and its CAS number is 170851-70-4.

## Research Focus & Mechanism Overview

### Where the Two Peptides Act

The GHRH receptor, which CJC-1295 No DAC binds, sits on pituitary somatotroph cells and works mostly through adenylyl cyclase and cAMP. Ipamorelin belongs to a separate arm of the field: it is studied at GHS-R1a, the ghrelin receptor, which couples mainly to phospholipase C and calcium.

Because the receptors and the downstream routes differ, a result for one peptide does not carry over to the other. A comparator for either one starts with the pathway under study, and each peptide should be named in methods by its sequence or CAS number.

### Four Edits to the Native GHRH Fragment

- Position 2: D-alanine replaces L-alanine, giving the same atoms in mirror-image geometry.
- Position 8: glutamine stands in for asparagine.
- Position 15: alanine stands in for glycine.
- Position 27: leucine stands in for methionine, which also takes the only sulfur atom out of the chain.

Counted up, the edits gain three CH2 groups and lose one sulfur, which leaves the peptide about 10 Da above Sermorelin, at 3367.9 against 3357.9 g/mol. Because D-alanine adds no atoms, that 10 Da gap says nothing about the configuration at position 2.

### Residue Makeup of the 29-Residue Peptide

The chain is made of five leucines and four alanines, with three glutamines, three serines and three arginines, two tyrosines, two lysines, two aspartic acids and two isoleucines, and a single phenylalanine, threonine and valine. Eight common residues never appear: cysteine, methionine, tryptophan, glycine, asparagine, proline, histidine and glutamic acid. With no cysteine there is no disulfide bond, and with no methionine or tryptophan the usual oxidation-prone residues are absent.

### What a Two-Peptide Pairing Can and Cannot Tell You

A finding that comes from CJC-1295 No DAC alone, or from Ipamorelin alone, describes that peptide in that experimental system. It does not describe the pair, and nothing on the listing claims a combined effect. This section is molecular reference material, and there is no dosing, administration or usage guidance anywhere in it.

## Quality & Purity Standards

### Mass Values for Checking a Bottle

Peptides of this size ionize in electrospray as several charge states, so a spectrum shows a ladder of peaks and not a single line at the neutral mass. These are calculated average-mass values, each equal to the reference mass plus a proton for every charge:
- CJC-1295 No DAC (about 3367.9 g/mol) should give charge states near m/z 1123.6 (3+), 843.0 (4+) and 674.6 (5+).
- Ipamorelin (about 711.85 g/mol) should give charge states near m/z 712.9 (1+) and 356.9 (2+).

The look-alikes land elsewhere. CJC-1295 with DAC (about 3647.2 g/mol) shows its 4+ ion near m/z 912.8, which is easy to spot, while Sermorelin (about 3357.9 g/mol) shows it near 840.5, only 2.5 units from the No DAC peptide, so separating those two takes a calibrated instrument. Salt forms and sodium or potassium adducts shift the observed peaks, so convert an observed value to a neutral mass first. A matching mass supports identity and says nothing about purity, and instrument-reported monoisotopic values usually read lower.

### Paperwork for a Spray Bottle

A lot document describes only the lot it names, so the first check is whether its lot number matches the one on the bottle. Fill volume, concentration and carrier are lot matters and not listing data, and the 45-spray count says how many sprays a bottle holds, not how much peptide each one delivers. For a two-peptide product, look for a separate identity result and amount for each peptide, plus the chemical form, the date of testing and the laboratory behind it.

Requests for documentation go through the contact page.

### Checks Researchers Ask About

### Can the 5/5 mg label alone settle what a bottle contains?

No. A label states a name and two figures, not a structure. The measured mass of each peptide is what ties a bottle to the sequences and formulas listed here.

### Why does the mass of the CJC peptide matter more than its name?

The name CJC-1295 covers both a 29-residue and a 30-residue compound. A reading near 3368 fits the No DAC peptide, a reading near 3647 describes a molecule about 279 Da heavier, and one near 3358 would be Sermorelin.

### Does a D-amino acid change the mass?

No. D and L forms share the same atoms, so D-Ala2 in CJC-1295 No DAC and D-2-Nal and D-Phe in Ipamorelin are invisible to a mass reading. Chiral amino acid analysis or a reference comparison is the way to support them.

### Need to ask about a bottle?

- Write to the Veracue team
- See the full research catalog

## Compliance Notice

### Research Use Only Notice

Each bottle of CJC/Ipamorelin Spray holds research material for laboratory work. It is not a medicine, a supplement, a cosmetic or a food, and it is not intended for use by or on people or animals. There is no dosing, administration or usage guidance of any kind anywhere in this listing. Only qualified researchers and institutions may order it, and they remain responsible for lawful handling. For sitewide policy, see the Medical Disclaimer and the Terms and Conditions.

## Questions and answers

### Which peptides are in CJC/Ipamorelin Spray?

CJC-1295 No DAC, the 29-residue Mod GRF 1-29 peptide with D-alanine at position 2, and Ipamorelin, the pentapeptide Aib-His-D-2-Nal-D-Phe-Lys-NH2. They are unrelated molecules that act at different receptors.

### How many sprays come in one bottle?

The bottle contains 45 sprays. That is a packaging count, and fill volume and concentration are not part of the listing data.

### How much of each peptide is in a bottle?

Five milligrams of each. The label’s 5/5 mg gives one figure per peptide, and the listing does not state an amount per spray.

### What is the sequence of the CJC-1295 No DAC peptide?

YADAIFTQSYRKVLAQLSARKLLQDILSR-NH2, 29 residues, with D-alanine at position 2. Compared with native GHRH(1-29) it has glutamine at 8, alanine at 15 and leucine at 27.

### Why does the name CJC-1295 need a qualifier?

It is used for two compounds that share one 29-residue backbone, one that ends there and one that adds a lysine carrying a maleimidopropionyl group, the DAC. The bottle holds the No DAC form, and the two differ in formula, mass and CAS number.

### How far apart are the No DAC and with-DAC masses?

About 279 Da, which is roughly 3367.9 against 3647.2 g/mol. The gap is the added lysine and its maleimidopropionyl group, C13H17N3O4.

### What is unusual about the Ipamorelin sequence?

Two of its five residues, aminoisobutyric acid and D-2-naphthylalanine, are non-standard, and its phenylalanine is the D isomer. Only histidine and lysine are standard L-amino acids.

### Which formula and CAS number belong to Ipamorelin?

The formula is C38H49N9O5, the average mass is about 711.85 g/mol and the CAS Registry Number is 170851-70-4.

### Which CAS numbers go with the CJC-1295 No DAC peptide?

Listings use 863288-34-0 and 446036-97-1 for it. A listing showing 446262-90-4 describes the with-DAC compound, and 86168-78-7 describes Sermorelin.

### Which receptors do the two peptides act on?

The GHRH receptor is the one CJC-1295 No DAC binds, with cAMP signaling. Ipamorelin targets GHS-R1a, the ghrelin receptor, where signaling runs through phospholipase C and calcium.

### What mass peaks should a spectrum of this bottle show?

The CJC-1295 No DAC peptide gives a ladder consistent with about 3367.9 g/mol, with its 4+ ion near m/z 843.0. Ipamorelin gives ions near m/z 712.9 (1+) and 356.9 (2+).

### What belongs in a lot document for this bottle?

A separate identity result and amount for each peptide, plus the chemical form, the lot number printed on the bottle, when it was tested and by which laboratory. One blended figure says little about either peptide.

### Where do documentation requests go?

Through the contact page, where documentation can be requested for the product in question.

### What does the Research Use Only label mean here?

It marks the contents as material for laboratory research and analysis, not for use by or on people or animals.

### Does Veracue say how the spray should be used?

No. There is no dosing, administration or usage guidance of any kind in the listing, and the bottle is a laboratory research item.

More from Veracue Labs: https://veracuelabs.com/llms.txt