# CJC-1295 No DAC

> Research use only. Not for human or veterinary use. Supplied by Veracue Labs.

- Page: https://veracuelabs.com/product/cjc-1295-no-dac
- Category: Growth Hormone Secretagogue
- Sizes and prices in USD: 10 mg at $87.99
- Certificate of analysis: none posted on the page. Request one for a specific lot at https://veracuelabs.com/contact-us.
- Prices are a snapshot from 2026-10-17. The product page shows the current price.

## Overview

CJC-1295 No DAC, also sold as Mod GRF 1-29, is a 29-residue growth hormone-releasing hormone analog with the sequence YADAIFTQSYRKVLAQLSARKLLQDILSR-NH2: D-alanine sits at position 2, and glutamine, alanine and leucine replace Asn8, Gly15 and Met27 of the native fragment. The free peptide is C152H252N44O42, average mass about 3367.9 g/mol, listed under CAS 863288-34-0 and 446036-97-1.

## Product Details

### What Is CJC-1295 No DAC?

CJC-1295 No DAC is a synthetic peptide of 29 amino acids, built on the first 29 residues of growth hormone-releasing hormone (GHRH) and finished with a C-terminal amide. Against the native fragment it carries four changes: D-alanine at position 2, glutamine at position 8, alanine at position 15 and leucine at position 27. Chemists also write it as Mod GRF 1-29, modified GRF(1-29) or tetrasubstituted GRF(1-29), and sellers use CJC-1295 without DAC or CJC-1295 W/O DAC for the same molecule.

The words "No DAC" carry chemical information. DAC stands for Drug Affinity Complex, a lysine bearing a maleimidopropionyl group that is added after residue 29 and is intended to link the peptide to albumin. This molecule ends at residue 29 and has no such group. Veracue supplies it for research use only.

### CJC-1295 No DAC at a Glance

Product name: CJC-1295 No DAC (also CJC-1295 without DAC, Mod GRF 1-29, modified GRF(1-29))
Sequence (three-letter code): Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
Sequence (one-letter code): YADAIFTQSYRKVLAQLSARKLLQDILSR-NH2, with D-alanine at position 2
Length: 29 residues, linear, C-terminal amide
Changes from native GHRH(1-29): D-Ala2, Gln8, Ala15, Leu27
Molecular formula (free-base reference value): C152H252N44O42
Molecular weight (average): About 3367.9 g/mol
CAS Registry Number: 863288-34-0 (446036-97-1 is also listed for this peptide)
Size offered: 10 mg vial
Research designation: Research Use Only

Formula and mass are reference values for the free peptide and are not a Veracue lot result. Salt form, purity, lot number and storage conditions for a particular vial are reported on its own documentation, which can be requested through the contact page.

### Compounds It Is Easily Mistaken For

- CJC-1295 with DAC, which adds a 30th residue (a lysine carrying a maleimidopropionyl group) and has its own formula, mass and CAS number.
- Sermorelin, the unmodified GHRH(1-29) amide, with L-alanine at position 2 and Asn, Gly and Met at positions 8, 15 and 27.
- Tesamorelin, a 44-residue chain with an N-terminal hexenoyl group.
- Ipamorelin, a short pentapeptide that acts at a different receptor.
- Any consumer, dietary or cosmetic product. This material is not intended for human or veterinary use.

## Research Focus & Mechanism Overview

### Reading the Sequence Against Sermorelin

The fastest way to understand CJC-1295 No DAC is to lay it beside the unmodified GHRH(1-29) amide, Sermorelin. Both chains are 29 residues long and they match at 25 of the 29 positions. The four that differ are the whole identity of the molecule.

Position: Sermorelin: CJC-1295 No DAC: What the change amounts to

2: L-Ala: D-Ala: Same atoms in mirror-image arrangement; designed to resist N-terminal cleavage by dipeptidyl peptidase IV
8: Asn: Gln: One extra CH2, and an asparagine prone to deamidation is gone
15: Gly: Ala: One extra CH2
27: Met: Leu: One extra CH2 and the only sulfur atom removed, so no methionine oxidation site remains

Added up, that is three CH2 groups gained and one sulfur lost. The formula therefore moves from C149H246N44O42S to C152H252N44O42 and the average mass rises by about 10 Da. D-alanine adds no atoms, so a mass reading by itself cannot tell D-Ala2 from L-Ala2.

### No DAC, With DAC and Sermorelin Side by Side

Feature: CJC-1295 No DAC: CJC-1295 with DAC: Sermorelin

Residues: 29: 30 (a lysine is added after residue 29): 29
Changes from native GHRH(1-29): D-Ala2, Gln8, Ala15, Leu27: The same four: None
C-terminal end: Arg29 amide: Lysine carrying a maleimidopropionyl group (the DAC), amide: Arg29 amide
Molecular formula: C152H252N44O42: C165H269N47O46: C149H246N44O42S
Average mass (g/mol): About 3367.9: About 3647: About 3357.9
CAS Registry Number: 863288-34-0 and 446036-97-1: 446262-90-4: 86168-78-7
Receptor context: GHRH receptor: GHRH receptor: GHRH receptor

The table separates identity only and does not rank the molecules. The with-DAC compound is a different material with its own product record and its own documentation, and its formula differs from the one above by C13H17N3O4.

### Where the Name Goes Wrong

### Why does a bare "CJC-1295" label leave the compound open?

The code CJC-1295 was first attached to the albumin-binding version, and the "No DAC" and "without DAC" tags were added later for the 29-residue chain. A label, listing or paper that says only "CJC-1295" does not say which of the two molecules it means, so the formula, mass or CAS number is a safer anchor than the name.

### Why do two CAS numbers appear for the No DAC peptide?

Catalogs list both 863288-34-0 and 446036-97-1 against this sequence, with the same formula and mass. Two other numbers are often pasted onto the wrong compound: 446262-90-4 belongs to CJC-1295 with DAC and 86168-78-7 belongs to Sermorelin. If a No DAC listing shows either of those, treat it as a mismatch to settle with the supplier.

### Receptor Context

Like Sermorelin and Tesamorelin, this analog is a GHRH receptor ligand. The GHRH receptor is a G protein-coupled receptor on pituitary somatotroph cells and signals mainly through adenylyl cyclase and cyclic AMP. Ipamorelin works through the ghrelin (GHS) receptor, which couples to phospholipase C and calcium, so the two molecules answer different pathway questions and are not substitutes.

Results from one experimental system describe that system only. When a paper says just "CJC-1295", check its methods for the structure to learn whether the 29-residue peptide or the albumin-conjugated one was used before comparing numbers across sources. Veracue offers molecular reference information here, and provides no dosing, administration or usage guidance of any kind.

## Quality & Purity Standards

### Separating the Look-Alikes by Mass

Three molecules in this family are easy to confuse, so a mass reading from the lot is the most practical identity check. Peptides of this size usually appear in ESI mass spectra as a series of multiply charged ions rather than at the neutral mass. The table gives calculated average-mass m/z values for the 3+ and 4+ ions of each reference formula.

Compound: Average mass (g/mol): 3+ ion (m/z): 4+ ion (m/z)

CJC-1295 No DAC: 3367.9: 1123.6: 843.0
Sermorelin: 3357.9: 1120.3: 840.5
CJC-1295 with DAC: About 3647: 1216.7: 912.8

No DAC and Sermorelin sit only 10 Da apart, roughly 3.3 units of m/z at 3+, so telling them apart needs a calibrated instrument with adequate resolution. The with-DAC compound lies far enough away to be obvious. Sodium and potassium adducts shift observed peaks, so convert an observed m/z back to a neutral mass before comparing it with the reference value.

Method: What it tells a researcher: What it cannot show alone

RP-HPLC: Chromatographic purity as peak area: Which molecule the main peak is
ESI-MS: Measured mass against the expected mass: Residue order, or D versus L configuration
Tandem MS: Fragment evidence for the sequence, including positions 8, 15 and 27: Overall purity or quantity
Chiral amino acid analysis: Whether alanine is present as the D form: Chain length or sequence order
Peptide content assay: How much of the vial contents is peptide rather than counterion and water: Identity of impurities

### Reading a CJC-1295 No DAC Certificate

Treat a certificate as a statement about one lot and nothing wider. Match its lot number to the vial first, then see which compound it names. A document that says only "CJC-1295" leaves the question open until you read the measured mass.

A useful certificate gives the chemical form, either free peptide or a salt such as acetate, because a counterion changes the expected mass. It also shows the observed and expected mass, the HPLC trace with its purity figure, the test date and the laboratory that ran the work. Documentation for a given lot can be requested as described on the certificate page.

### Verification Questions

### Does a purity percentage show that the vial holds CJC-1295 No DAC?

No. A single clean HPLC peak says the detected material behaves alike, not that it is the right peptide. A wrong but well-made compound can score just as high, which is why the purity figure has to sit next to a mass result from the same lot.

### What would a mass near 3647 or near 3358 suggest?

A reading near 3647 g/mol fits the with-DAC compound, and one near 3358 g/mol fits Sermorelin. Either result would mean the material is not CJC-1295 No DAC, or that the form or adducts need to be reconciled with the paperwork.

### What belongs in a record for each lot?

Keep the listing as it read when you ordered, the lot-specific certificate, the stated chemical form, the measured mass, the receipt date and the experiments that used the material. A consistent file makes it easy to trace an unexpected result back to a lot.

### Need paperwork for a specific lot?

Ask the Veracue team which documentation exists for your lot, or look through the published certificates.

- Contact the Veracue team
- Browse certificates
- Return to the research catalog

## Compliance Notice

### Research Use Only Notice

CJC-1295 No DAC is supplied for laboratory research and analytical characterization only. It is not intended for human or veterinary use, or for ingestion, injection or any other form of administration, and it is not a drug, dietary supplement, cosmetic or food. Veracue provides no dosing, administration or usage guidance of any kind. Buyers must be qualified researchers or institutions and are responsible for lawful handling of the material. The Medical Disclaimer and the Terms and Conditions set out the sitewide policies.

## Questions and answers

### What is CJC-1295 No DAC?

It is a synthetic 29-residue analog of the first 29 amino acids of growth hormone-releasing hormone, with a C-terminal amide and four substitutions: D-Ala2, Gln8, Ala15 and Leu27. It lacks the albumin-binding DAC group, and Veracue supplies it for laboratory research only.

### What does DAC stand for in CJC-1295?

Drug Affinity Complex, a lysine carrying a maleimidopropionyl group that is added after residue 29 and is intended to link the peptide to albumin. "No DAC" means the chain ends at residue 29 with no such group.

### Is CJC-1295 No DAC the same as Mod GRF 1-29?

Yes. Mod GRF 1-29, modified GRF(1-29), tetrasubstituted GRF(1-29), CJC-1295 without DAC and CJC-1295 W/O DAC all name the same 29-residue peptide. When comparing sources, check the sequence rather than the label.

### Which four residues differ from native GHRH(1-29)?

Position 2 is D-alanine instead of L-alanine, position 8 is glutamine instead of asparagine, position 15 is alanine instead of glycine and position 27 is leucine instead of methionine.

### What are the molecular formula and mass of CJC-1295 No DAC?

The free peptide is C152H252N44O42 with an average mass of about 3367.9 g/mol. A salt form weighs more, so the form named on the lot documentation decides which value applies.

### Which CAS number goes with CJC-1295 No DAC?

Catalogs list 863288-34-0 and 446036-97-1 for this peptide. The numbers 446262-90-4 (CJC-1295 with DAC) and 86168-78-7 (Sermorelin) belong to other compounds.

### How does CJC-1295 No DAC differ from CJC-1295 with DAC?

The with-DAC compound adds a 30th residue, a lysine bearing a maleimidopropionyl group, which lifts the formula to C165H269N47O46 and the mass to about 3647 g/mol. Both share the same four substitutions, so the extra group and the mass are what set them apart.

### How does CJC-1295 No DAC differ from Sermorelin?

Sermorelin is the unmodified GHRH(1-29) amide, C149H246N44O42S at about 3357.9 g/mol. CJC-1295 No DAC differs at positions 2, 8, 15 and 27, which makes it about 10 Da heavier and sulfur-free.

### Does CJC-1295 No DAC act at the same receptor as Ipamorelin?

No. CJC-1295 No DAC is a GHRH receptor ligand, while Ipamorelin acts at the ghrelin (GHS) receptor, a different pathway. They are separate molecules with separate documentation.

### How can I confirm a vial holds the No DAC form?

Compare the lot’s measured mass with about 3367.9 g/mol and make sure the certificate carries the same lot number as the vial. A reading near 3647 points to the with-DAC compound and one near 3358 points to Sermorelin.

### What size does Veracue sell CJC-1295 No DAC in?

A 10 mg vial, supplied strictly for laboratory research use only.

### What does Research Use Only mean for this product?

The material is supplied for laboratory research and analysis, not for human or veterinary use, ingestion, injection or any form of administration.

### Does Veracue give usage instructions for CJC-1295 No DAC?

No. This material is offered for laboratory research use only, and Veracue provides no dosing, administration or usage guidance of any kind.

More from Veracue Labs: https://veracuelabs.com/llms.txt