# CJC-1295 No DAC Spray

> Research use only. Not for human or veterinary use. Supplied by Veracue Labs.

- Page: https://veracuelabs.com/product/cjc-1295-no-dac-spray
- Category: Nasal Sprays
- Sizes and prices in USD: 10 mg at $104.49
- Certificate of analysis: none posted on the page. Request one for a specific lot at https://veracuelabs.com/contact-us.
- Prices are a snapshot from 2026-10-17. The product page shows the current price.

## Overview

CJC-1295 No DAC Spray is a spray-dispensed form of modified GRF(1-29), a tetrasubstituted analog of the N-terminal 29-residue fragment of GHRH that ends in a C-terminal amide. Its changes from the native fragment are D-Ala2, Gln8, Ala15 and Leu27. Free-peptide reference values are C152H252N44O42 and an average mass near 3367.9 g/mol, with CAS 863288-34-0 and 446036-97-1 both appearing in supplier listings. No lysine-linked albumin-binding group is present, and the mass sits roughly 10 Da above Sermorelin.

## Product Details

### Spray Product Snapshot

Product name: CJC-1295 No DAC Spray (the peptide is also called Mod GRF 1-29 or modified GRF(1-29))
Packaging: Spray-dispensed bottle, 45 sprays per bottle
Size offered: 10 mg
Peptide: Linear 29-residue analog of GHRH(1-29), C-terminal amide
Sequence (one-letter code): YADAIFTQSYRKVLAQLSARKLLQDILSR-NH2 (the alanine at position 2 is the D isomer)
Sequence (three-letter code): Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
Edits to native GHRH(1-29): D-Ala2, Gln8, Ala15, Leu27
Molecular formula (free peptide): C152H252N44O42
Average molecular weight (free peptide): About 3367.9 g/mol
CAS Registry Number: 863288-34-0 (446036-97-1 appears in other listings of the same peptide)
Research designation: Research Use Only

The identity values describe the free peptide as a reference structure and are not a lot result. Concentration, fill volume, carrier, salt form, purity and storage conditions belong to each lot’s own paperwork, and the contact page is the place to ask for it.

### The Peptide Behind the Spray

The active ingredient is a synthetic chain of 29 amino acids that follows the first 29 positions of growth hormone-releasing hormone (GHRH) and is capped with an amide. Four positions were edited, which is why the same molecule turns up as tetrasubstituted GRF(1-29), modified GRF(1-29), Mod GRF 1-29, CJC-1295 without DAC and CJC-1295 W/O DAC. Veracue supplies it in a spray-dispensed bottle of 45 sprays, solely for research use.

Nothing is attached beyond the 29 residues. Where the name says "No DAC", it points to the absence of the Drug Affinity Complex, the albumin-directed group that distinguishes a related compound.

### What Sets It Apart From Its Namesakes

CJC-1295 with DAC keeps the same four edits and then extends the chain by one lysine whose side chain bears a maleimidopropionyl unit. That extension changes the formula to C165H269N47O46, moves the average mass to roughly 3647 g/mol and gives the compound a CAS number of its own, 446262-90-4, and separate lot paperwork.

Sermorelin is the unedited GHRH(1-29) amide: L-alanine at position 2, asparagine at 8, glycine at 15 and methionine at 27, formula C149H246N44O42S, CAS 86168-78-7. Tesamorelin runs to 44 residues and has a hexenoyl cap at the N-terminus, and Ipamorelin is a short pentapeptide acting at a different receptor. None of them can stand in for this peptide in a methods section.

## Research Focus & Mechanism Overview

### Receptor Context for a GHRH Analog

This peptide is a ligand of the GHRH receptor, a G protein-coupled receptor found on pituitary somatotroph cells. Its signaling runs chiefly via adenylyl cyclase and cAMP, the route reported for Sermorelin and Tesamorelin as well. Ipamorelin belongs to a different arm of growth hormone research, because it acts at the ghrelin (GHS) receptor, whose signaling runs through phospholipase C and calcium.

Choosing a comparator therefore starts with the pathway being tested. GHRH-receptor questions call for GHRH-family ligands, and ghrelin-receptor questions call for secretagogues, with each molecule named precisely in the methods.

### Four Edits to the Native GHRH Fragment

- Position 2 carries D-alanine where native GHRH has L-alanine. The atoms are identical and only the geometry differs, a change aimed at the dipeptidyl peptidase IV cleavage site near the N-terminus.
- Position 8 carries glutamine where native GHRH has asparagine, which removes a residue that is prone to deamidation.
- Position 15 carries alanine where native GHRH has glycine.
- Position 27 carries leucine where native GHRH has methionine, which removes the only sulfur-containing residue and with it a site open to oxidation.

Counting residues gives five leucines, four alanines, three each of glutamine, serine and arginine, two each of tyrosine, lysine, aspartic acid and isoleucine, and one each of phenylalanine, threonine and valine. There is no cysteine, glycine, asparagine, methionine, tryptophan or proline in the chain, so no disulfide bond is possible and the usual oxidation-prone residues are absent.

### What the Missing DAC Group Means for Identity

Strip the DAC lysine from the with-DAC compound and the 29-residue chain left behind is this molecule. The mass accounts for the difference exactly: the added lysine and its maleimidopropionyl group contribute C13H17N3O4, about 279 Da. A mass reading is therefore a decisive test between the two, far easier to read than any difference in chromatographic behavior.

### Sermorelin as the Nearest Relative

Against Sermorelin the gap is small. The three added CH2 groups raise the mass, and the lost sulfur lowers it, so the net result is about 10 Da, from 3357.9 to 3367.9 g/mol. The two share the same length and agree at 25 of 29 positions, and a D-Ala2 swap alone would leave the mass unchanged, so mass evidence needs to be read alongside sequence evidence.

### Handling the Bare Name in Literature

### What should be checked when a paper says only "CJC-1295"?

The code CJC-1295 first belonged to the albumin-binding compound, and later usage added "No DAC" or "without DAC" for the shorter chain without always applying the split consistently. Look in the methods for the structure, the formula or a CAS number to learn which molecule was used, because findings from one do not automatically carry over to the other. The text above is molecular reference material only, and Veracue provides no dosing, administration or usage guidance of any kind.

## Quality & Purity Standards

### What a Mass Spectrum Should Show

For a peptide near 3.4 kDa, electrospray analysis normally produces several multiply charged peaks rather than one peak at the neutral mass. These are the calculated average-mass values for the ions most often inspected:
- CJC-1295 No DAC, 3367.9 g/mol: 4+ ion near m/z 843.0 and 5+ ion near m/z 674.6.
- Sermorelin, 3357.9 g/mol: 4+ ion near m/z 840.5 and 5+ ion near m/z 672.6.
- CJC-1295 with DAC, about 3647 g/mol: 4+ ion near m/z 912.8 and 5+ ion near m/z 730.4.

Sermorelin and this peptide fall about 2.5 units apart at 4+, so a calibrated instrument is needed to separate them, while the with-DAC compound is unmistakable. Adducts and salt forms move observed peaks, so a report should convert observed values to a neutral mass and state the form used for the expected value. A matching mass supports identity but says nothing about purity.

### Paperwork for a Spray Bottle

A certificate speaks for the lot it names and for nothing else, so start by matching its lot number to the bottle in hand. For a spray-dispensed product, items such as concentration, fill volume and carrier are lot-specific matters and are found on that lot’s own documentation rather than on this listing. The 45-sprays-per-bottle figure is a packaging count and not a statement about peptide content.

Paperwork for your lot can be requested through the certificate page. A complete report names the chemical form and gives observed against expected mass, the purity figure from HPLC with its chromatogram, plus the date of testing and the laboratory behind it.

### Checks Researchers Ask About

### Can HPLC purity alone settle which CJC-1295 a lot contains?

No. HPLC reports how much of the detected material elutes as the main peak, and it would score a clean sample of a related peptide just as well. Identity comes from the mass result and, where needed, fragment data covering positions 2, 8, 15 and 27.

### What does D-alanine do to the analysis?

Nothing shows up in the mass, because D-Ala and L-Ala have identical atoms. Confirming the D configuration at position 2 depends on how the chain was built or on chiral amino acid analysis, so ask what evidence a lot offers on that point.

### What goes into a lot file for this listing?

Save the listing text from the day of purchase, the lot certificate, the chemical form it names and the measured mass, with a note of when the bottle arrived and which experiments drew on it. That record makes later comparisons between lots straightforward.

### Questions about a lot?

Write to the Veracue team about documentation, or open the published certificates.

- Write to the Veracue team
- Open the certificates
- See the full research catalog

## Compliance Notice

### Research Use Only Notice

CJC-1295 No DAC Spray is a laboratory reagent. It is sold for research and analysis alone, is not a medicine, supplement, cosmetic or food, and is not meant for people or animals in any way. Veracue provides no dosing, administration or usage guidance of any kind. Orders are for qualified researchers and institutions, who remain responsible for lawful handling. Sitewide terms are set out in the Medical Disclaimer and the Terms and Conditions.

## Questions and answers

### What peptide is in CJC-1295 No DAC Spray?

It is the 29-residue analog of GHRH(1-29) with a C-terminal amide and four edits from the native fragment: D-Ala2, Gln8, Ala15 and Leu27. Nothing is appended after residue 29, so there is no albumin-binding group.

### How many sprays does one bottle hold?

Each 10 mg bottle contains 45 sprays. That count is a packaging fact, and fill volume and concentration are recorded on the lot’s documentation.

### Why is this peptide called both CJC-1295 No DAC and modified GRF(1-29)?

The first name marks it against the DAC-bearing compound, and the second describes it as GRF(1-29) with four modifications. Tetrasubstituted GRF(1-29), Mod GRF 1-29 and CJC-1295 without DAC are further names for the same molecule.

### Why does the chain contain no methionine, glycine or asparagine?

Those three native residues sit at positions 27, 15 and 8, and the edited peptide has leucine, alanine and glutamine there instead. Position 2 is the D isomer of alanine, which leaves the atom count unchanged.

### What mass should a lot of this peptide show?

Roughly 3367.9 g/mol for the free peptide (C152H252N44O42). In an electrospray spectrum that appears as ions such as the 4+ peak near m/z 843.0, and a salt form carries extra mass.

### Which CAS numbers are used for it, and which should raise a flag?

Listings use 863288-34-0 and 446036-97-1 for this peptide. A listing showing 446262-90-4 describes the with-DAC compound, and 86168-78-7 describes Sermorelin.

### What separates this peptide from CJC-1295 with a DAC group?

The with-DAC compound carries one additional lysine after residue 29, with a maleimidopropionyl unit on its side chain. That addition makes it about 279 Da heavier, with the formula C165H269N47O46.

### How far apart are the masses of this peptide and Sermorelin?

About 10 Da, with this peptide at about 3367.9 g/mol and Sermorelin at about 3357.9 g/mol. Three extra CH2 groups are offset by the loss of one sulfur atom.

### Which signaling pathway is linked to the GHRH receptor?

The GHRH receptor is found on pituitary somatotroph cells, where signaling runs mainly via adenylyl cyclase and cAMP. Ipamorelin is a separate molecule that acts at the ghrelin receptor instead.

### Which lot details are specific to a spray-dispensed product?

Concentration, fill volume and carrier, along with the usual chemical form and purity data. They are recorded on each lot’s documentation rather than on the listing.

### What should a certificate for this lot contain?

The chemical form, a lot number that matches the bottle, an HPLC chromatogram with its purity result, observed and expected mass, the test date and the laboratory.

### How should the Research Use Only label on the bottle be read?

It marks the contents as a laboratory reagent for analysis and research, and not as something for people or animals.

### Does Veracue provide instructions for using the spray?

No. The bottle is a research item, and Veracue provides no dosing, administration or usage guidance of any kind.

More from Veracue Labs: https://veracuelabs.com/llms.txt